DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6893 and CG9582

DIOPT Version :9

Sequence 1:NP_001369058.1 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_001285773.1 Gene:CG9582 / 34230 FlyBaseID:FBgn0032090 Length:300 Species:Drosophila melanogaster


Alignment Length:177 Identity:40/177 - (22%)
Similarity:75/177 - (42%) Gaps:21/177 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 LVAALAGCVAGVVGTPMELINTRMQVNRALPKETRWNYRNVFDGLYRVTREEGFTKLYSG----- 166
            |...|:|.:..:...|::::.||||:..|.|......|....|.:.::.|.||.:.|:.|     
  Fly    18 LAGGLSGFIEIICFHPLDVVKTRMQIQGAHPFGGEVVYTCPLDAIVKIYRYEGLSSLWKGIVPPI 82

  Fly   167 CFLSFMRSSLITISQNAAYDQAKQIYAEFFHMKHDNTLLHLISSVTAAFVCGPIIKPIENLRYLR 231
            |..:..|.....:     |:..|..:.  |.......|.|.:|...||.:...::.|.|.::..:
  Fly    83 CVETPKRGGKFLM-----YESLKPYFQ--FGAPQPTPLTHAMSGSMAAILESFLVNPFEVVKITQ 140

  Fly   232 MVDSRRLINSIS---YMMR---FGSRGPFRGMVPYVLRMVPNTVITF 272
            .....:.:.::|   |:::   :|.:|.:||:...|.|   |.|..|
  Fly   141 QAHRGKRLKTLSVVKYIIKHDGYGIKGLYRGITALVAR---NAVFHF 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6893NP_001369058.1 Mito_carr 20..96 CDD:395101
Mito_carr 98..192 CDD:395101 21/89 (24%)
CG9582NP_001285773.1 PTZ00169 17..296 CDD:240302 40/177 (23%)
Mito_carr 17..104 CDD:278578 21/90 (23%)
Mito_carr 109..196 CDD:278578 18/79 (23%)
Mito_carr 216..295 CDD:278578
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441954
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.