DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6893 and MME1

DIOPT Version :9

Sequence 1:NP_001369058.1 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_609093.1 Gene:MME1 / 33987 FlyBaseID:FBgn0031881 Length:299 Species:Drosophila melanogaster


Alignment Length:294 Identity:72/294 - (24%)
Similarity:113/294 - (38%) Gaps:41/294 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KKIRP--RWWSGGVAGAIAQCFTAPFDLIEARMVVI--------KKDRGMASNLQQAIRTHGFIS 66
            ||..|  .:.:|||.|........|.|.|:.|:..:        .:.:|:.....:..|..||..
  Fly    10 KKSNPVKSFIAGGVGGMCNVLVGHPLDTIKVRLQTMPTPPPGQPPRYKGVIDCAARTFRYEGFRG 74

  Fly    67 LYDGLSAQLLRQLTYTSMRFHLYEMGKE--HLDDPAGLLDKVLVA--ALAGCVAGVVGTPMELIN 127
            .|.|:||.|:......::.|.:|..||.  ..||...|....:.|  ||||..:.:|..|.:.|.
  Fly    75 FYRGISAPLVGVTPIYAVDFAVYAAGKRLFQTDDHIRLTYPQIFAAGALAGVCSALVTVPTDRIK 139

  Fly   128 TRMQVNRALPKETRWN----YRNVFDGLYRVTREEGFTKLYSGCFLSFMRSSLITISQNAAYDQA 188
            ..:|.      :|..|    |....|...::.|:.|...|:.|.....:|.     |....|...
  Fly   140 VLLQT------QTVSNGPLLYNGTIDTAAKLYRQGGIRSLFKGTCACILRD-----SPTGFYFVT 193

  Fly   189 KQIYAEFFHMKHDN----TLLHLISSVTAAFVCGPIIKPIENLRYLRMVDS-----RRLINSI-- 242
            .:...|....|..|    |...::|..||..|...:..|.:.|: .|:..:     :..|.|:  
  Fly   194 YEFLQELARKKSANGKISTTSTILSGGTAGIVFWTLAVPFDVLK-SRLQSAPEGTYKHGIRSVFR 257

  Fly   243 SYMMRFGSRGPFRGMVPYVLRMVPNTVITFLSFE 276
            :.|...|.:..|||::|.:||..|:|...|...|
  Fly   258 NLMATEGPKALFRGILPILLRAFPSTAAVFFGVE 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6893NP_001369058.1 Mito_carr 20..96 CDD:395101 21/85 (25%)
Mito_carr 98..192 CDD:395101 22/99 (22%)
MME1NP_609093.1 Mito_carr 10..107 CDD:278578 24/96 (25%)
Mito_carr 111..205 CDD:278578 22/104 (21%)
Mito_carr 208..297 CDD:278578 22/85 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441729
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.