DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6893 and Ucp4B

DIOPT Version :9

Sequence 1:NP_001369058.1 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_608977.1 Gene:Ucp4B / 33833 FlyBaseID:FBgn0031758 Length:337 Species:Drosophila melanogaster


Alignment Length:311 Identity:78/311 - (25%)
Similarity:137/311 - (44%) Gaps:48/311 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VIKTKKIRP--RWWSGGVAGAIAQCFTAPFDLIEARMVV----------IKKDRGMASNLQQAIR 60
            ::..||..|  .:.:...:...|:....|||:.:.||.:          ..|.||:.:.....:|
  Fly    28 LVTNKKTPPVELYLTAFASACSAEIVGYPFDMCKTRMQIQGEIASRVGQKAKYRGLLATAMGIVR 92

  Fly    61 THGFISLYDGLSAQLLRQLTYTSMRFHLYEMGKEHLDDP-------AGLLDKVLVAALAGCVAGV 118
            ..|.:.||.|:||.|.|...::.::...|:..:|.:..|       ...|...:...|||..|.|
  Fly    93 EEGLLKLYGGISAMLFRHSLFSGIKMLTYDYMREKMIVPDEDGRPQLSFLGSCISGVLAGATASV 157

  Fly   119 VGTPMELINTRMQV--NRALPKETRWNYRNVFDGLYRVTREEGFTKLYSGCFLSFMRSSLITISQ 181
            :..|.|||..:||:  .|.|..|.. ...||...|..:.|..|...|:.|...:..||:|:||..
  Fly   158 LTNPTELIKIQMQMEGQRRLRGEPP-RIHNVLQALTSIYRTGGVVGLWKGTVPNTWRSALVTIGD 221

  Fly   182 NAAYDQAKQ-IYAEFFHMKHDNTLLHLISSVTAAFVCGPIIKPIENLRYLRMVDSRRL------- 238
            .:.||..|: :.|||..:  ||..:..::::||......:..|.:      :|.||.:       
  Fly   222 VSCYDFCKRFLIAEFDLV--DNREVQFVAAMTAGVADAILSLPAD------VVKSRIMNQPTDEQ 278

  Fly   239 ---------INSISYMMR-FGSRGPFRGMVPYVLRMVPNTVITFLSFEQLR 279
                     ::.:|.::| .|....::|.:||.:|:.|.:|:.:::|||:|
  Fly   279 GRGIHYKGSLDCLSRLVREEGFLAMYKGFIPYWMRVGPASVVFWMTFEQIR 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6893NP_001369058.1 Mito_carr 20..96 CDD:395101 20/85 (24%)
Mito_carr 98..192 CDD:395101 31/103 (30%)
Ucp4BNP_608977.1 PTZ00169 32..306 CDD:240302 68/282 (24%)
Mito_carr 32..129 CDD:278578 23/96 (24%)
Mito_carr 138..233 CDD:278578 30/95 (32%)
Mito_carr 246..331 CDD:278578 19/90 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441643
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D984118at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45618
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.