DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6893 and colt

DIOPT Version :9

Sequence 1:NP_001369058.1 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_477221.1 Gene:colt / 33470 FlyBaseID:FBgn0019830 Length:306 Species:Drosophila melanogaster


Alignment Length:306 Identity:66/306 - (21%)
Similarity:115/306 - (37%) Gaps:52/306 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KRVIKTKKIRP--RWWSGGVAGAIAQCFTAPFDLIEARMVVIKKD--------RGMASNLQQAIR 60
            :.|...:|..|  .:.:||..|........|.|.|:.|:..:.:.        ||......:.|:
  Fly     5 ENVSTERKANPVKSFLTGGFGGICNVLSGHPLDTIKVRLQTMPRPAPGEQPLYRGTFDCAAKTIK 69

  Fly    61 THGFISLYDGLSAQLLRQLTYTSMRFHLYEMGK---EHLDDPAGLLDKVLVA-ALAGCVAGVVGT 121
            ..|...||.|:||.|.......:|.|..|.:||   :..:|......::.|| :.:|..:.::..
  Fly    70 NEGVRGLYKGMSAPLTGVAPIFAMCFAGYALGKRLQQRGEDAKLTYPQIFVAGSFSGLFSTLIMA 134

  Fly   122 PMELINTRMQVNRALPKETRWNYRNVFDGLYRVTREEGFTKLYSGCFLSFMR----SSLITISQN 182
            |.|.|...:|..:....|.::|  .:.|...::.:|.|...::.|...:.:|    :.|..:...
  Fly   135 PGERIKVLLQTQQGQGGERKYN--GMIDCAGKLYKEGGLRSVFKGSCATMLRDLPANGLYFLVYE 197

  Fly   183 AAYDQAKQIYAEFFHMKHDNTLLHLISSVTAAFVCGP----IIKPIENLRYLRMVDSRRLINSIS 243
            |..|.||.        |.:...:...|::.|..|.|.    :..|.:.|:       .||.::..
  Fly   198 ALQDVAKS--------KSETGQISTASTIFAGGVAGMAYWILGMPADVLK-------SRLQSAPE 247

  Fly   244 YMMRFGSR----------GP---FRGMVPYVLRMVPNTVITFLSFE 276
            ...:.|.|          ||   :||:.|.:||..|.....|...|
  Fly   248 GTYKHGIRSVFKDLIVKDGPLALYRGVTPIMLRAFPANAACFFGIE 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6893NP_001369058.1 Mito_carr 20..96 CDD:395101 22/86 (26%)
Mito_carr 98..192 CDD:395101 20/98 (20%)
coltNP_477221.1 Mito_carr 12..107 CDD:395101 24/94 (26%)
Mito_carr 112..202 CDD:395101 16/91 (18%)
Mito_carr 210..299 CDD:395101 20/91 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441723
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.