DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6893 and Ant2

DIOPT Version :10

Sequence 1:NP_001369058.1 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_511110.1 Gene:Ant2 / 32008 FlyBaseID:FBgn0025111 Length:307 Species:Drosophila melanogaster


Alignment Length:187 Identity:47/187 - (25%)
Similarity:79/187 - (42%) Gaps:22/187 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 SGGVAGAIAQCFTAPFDLIEARMVVIKKDRGMASN---------LQQAIRTHGFISLYDGLSAQL 75
            |||.|||.:.||..|.|....|:..   |.|...|         |.:.|::.|.|.||.|....:
  Fly   129 SGGAAGATSLCFVYPLDFARTRLAA---DVGKGGNREFNGLIDCLMKVIKSDGPIGLYRGFIVSV 190

  Fly    76 LRQLTYTSMRFHLYEMGKEHLDDPAGLLDKV--LVAALAGCVAGVVGTPMELINTRMQVNRALPK 138
            ...:.|.:..|..|:..::.|.:|......|  .:|.:...|||:...|.:.:..||.:...| |
  Fly   191 QGIVIYRAAYFGFYDTCRDFLPNPKSTPFYVSWAIAQVVTTVAGIASYPFDTVRRRMMMQSGL-K 254

  Fly   139 ETRWNYRNVFDGLYRVTREEGFTKLYSGCFLSFMR---SSLITISQNAAYDQAKQIY 192
            ::...|:|.......:.::||....:.|...:.:|   .:|:.    |.||:.|:.:
  Fly   255 KSEMVYKNTAHCWLVIAKQEGIGAFFKGALSNIIRGTGGALVL----ALYDEMKKYF 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6893NP_001369058.1 Mito_carr 20..96 CDD:395101 24/84 (29%)
Mito_carr 98..192 CDD:395101 22/98 (22%)
Ant2NP_511110.1 PTZ00169 15..305 CDD:240302 46/183 (25%)

Return to query results.
Submit another query.