DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6893 and sesB

DIOPT Version :9

Sequence 1:NP_001369058.1 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_727448.1 Gene:sesB / 32007 FlyBaseID:FBgn0003360 Length:312 Species:Drosophila melanogaster


Alignment Length:183 Identity:43/183 - (23%)
Similarity:78/183 - (42%) Gaps:16/183 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 SGGVAGAIAQCFTAPFDLIEARMVV------IKKDRGMASNLQQAIRTHGFISLYDGLSAQLLRQ 78
            |||.|||.:.||..|.|....|:..      .::..|:.:.|.:..::.|.:.||.|....:...
  Fly   134 SGGAAGATSLCFVYPLDFARTRLAADTGKGGQREFTGLGNCLTKIFKSDGIVGLYRGFGVSVQGI 198

  Fly    79 LTYTSMRFHLYEMGKEHLDDPAG--LLDKVLVAALAGCVAGVVGTPMELINTRMQVNRALPKETR 141
            :.|.:..|..|:..:..|.||..  :.....:|.:...|||:|..|.:.:..||.:... .|.|.
  Fly   199 IIYRAAYFGFYDTARGMLPDPKNTPIYISWAIAQVVTTVAGIVSYPFDTVRRRMMMQSG-RKATE 262

  Fly   142 WNYRNVFDGLYRVTREEGFTKLYSGCFLSFMR---SSLITISQNAAYDQAKQI 191
            ..|:|.......:.::||....:.|.|.:.:|   .:.:.:    .||:.|::
  Fly   263 VIYKNTLHCWATIAKQEGTGAFFKGAFSNILRGTGGAFVLV----LYDEIKKV 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6893NP_001369058.1 Mito_carr 20..96 CDD:395101 20/81 (25%)
Mito_carr 98..192 CDD:395101 22/99 (22%)
sesBNP_727448.1 Mito_carr 19..116 CDD:278578
PTZ00169 23..312 CDD:240302 43/183 (23%)
Mito_carr 124..220 CDD:278578 22/85 (26%)
Mito_carr 223..312 CDD:278578 20/94 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441941
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.