DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6893 and CG1628

DIOPT Version :9

Sequence 1:NP_001369058.1 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_572639.2 Gene:CG1628 / 31990 FlyBaseID:FBgn0030218 Length:459 Species:Drosophila melanogaster


Alignment Length:288 Identity:63/288 - (21%)
Similarity:107/288 - (37%) Gaps:44/288 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 SGGVAGAIAQCFTAPFDLIEARMVVIKKD-RGMASNLQQAIRTHGFI-SLYDGLSAQLLRQLTYT 82
            :|.:.||.....:.|.|.::.::....:. |||........|..|.: .||.|....:...:...
  Fly   175 AGSLGGAAQVYVSQPLDTVKVKLQTFPEAYRGMLDCFLSTYRKDGVLRGLYAGSVPAVFANVAEN 239

  Fly    83 SMRFHLYE---------MGKEHLDDPAGLLDKVLVAALAGCVAGVVGTPMELINTRMQ------- 131
            |:.|..|.         :|||...| ...:......:||.|.:.:...|.|||..::|       
  Fly   240 SVLFAAYGGCQKFVAFCVGKETAGD-LTTVQNACAGSLAACFSTLTLCPTELIKCKLQALREMKN 303

  Fly   132 -VNRALPKETR--WNYRNVFDGLYRVTREEGFTKLYSGCFLSFMRSSLITISQNAAYDQAKQIYA 193
             |..|.|::.|  |.....      :.|.||....|.|...:|:|..........:|:..:::..
  Fly   304 FVEPAHPQDIRTPWTLTRY------IWRTEGIRGFYRGLSSTFLREMPGYFFFFGSYEGTRELLR 362

  Fly   194 EFFHMKHDNTLLHLISSVTAAFVC-------GPIIK---PIENLRYLRMVDSRRLINSISYMMRF 248
            .....|.|...|..:.:.....||       ..:||   .::||.     :|...:.: ..:.|.
  Fly   363 RDDQSKDDIGPLRTMIAGAIGGVCLWTSTFPADVIKSRIQVKNLN-----ESMFAVGA-DIVRRE 421

  Fly   249 GSRGPFRGMVPYVLRMVPNTVITFLSFE 276
            |....:||::|.|||.:|.|...|:.:|
  Fly   422 GVLALYRGLLPSVLRTIPATATLFVVYE 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6893NP_001369058.1 Mito_carr 20..96 CDD:395101 19/86 (22%)
Mito_carr 98..192 CDD:395101 22/103 (21%)
CG1628NP_572639.2 PTZ00169 162..455 CDD:240302 63/288 (22%)
Mito_carr 170..252 CDD:278578 16/76 (21%)
Mito_carr 263..364 CDD:278578 22/107 (21%)
Mito_carr 369..455 CDD:278578 21/87 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441848
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.