DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6893 and Slc25a10

DIOPT Version :9

Sequence 1:NP_001369058.1 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_038798.2 Gene:Slc25a10 / 27376 MGIID:1353497 Length:287 Species:Mus musculus


Alignment Length:283 Identity:107/283 - (37%)
Similarity:165/283 - (58%) Gaps:25/283 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RWWSGGVAGAIAQCFTAPFDLIEARMVVIKKDR----GMASNLQQAIRTHGFISLYDGLSAQLLR 77
            ||:.||:|...|.|.|.|.||::..:...::.:    |||   .|.:||.||::||:||||.|.|
Mouse     8 RWYFGGLASCGAACCTHPLDLLKVHLQTQQEVKLRMTGMA---LQVVRTDGFLALYNGLSASLCR 69

  Fly    78 QLTYTSMRFHLYEMGKEHL----DDPAGLLDKVLVAALAGCVAGVVGTPMELINTRMQVNRALPK 138
            |:||:..||.:||..::::    ..|....:|||:..::|...|.||||.:|:|.|||.:..||.
Mouse    70 QMTYSLTRFAIYETMRDYMTKDSQGPLPFYNKVLLGGISGLTGGFVGTPADLVNVRMQNDMKLPP 134

  Fly   139 ETRWNYRNVFDGLYRVTREEGFTKLYSGCFLSFMRSSLITISQNAAYDQAKQIYAEFFHMKHDNT 203
            ..|.||.:..||||||.|||...||:||..::..|.:|:|:.|.:.||||||:.....::. ||.
Mouse   135 SQRRNYSHALDGLYRVAREESLRKLFSGATMASSRGALVTVGQLSCYDQAKQLVLSTGYLS-DNI 198

  Fly   204 LLHLISSV----TAAFVCGPIIKPIENLRYLRMVDSRRLINSISY-MMRFGSRGP---FRGMVPY 260
            ..|.:||.    .|.|:|    :|::.|: .|:::|:.....:.: .|.....||   |:|:.|.
Mouse   199 FTHFVSSFIAGGCATFLC----QPLDVLK-TRLMNSKGEYQGVFHCAMETAKLGPQAFFKGLFPA 258

  Fly   261 VLRMVPNTVITFLSFEQLRVNFG 283
            .:|::|:||:||:..||||.:||
Mouse   259 GIRLIPHTVLTFMFLEQLRKHFG 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6893NP_001369058.1 Mito_carr 20..96 CDD:395101 32/79 (41%)
Mito_carr 98..192 CDD:395101 43/93 (46%)
Slc25a10NP_038798.2 Solcar 1 7..87 34/81 (42%)
Mito_carr 12..92 CDD:278578 32/82 (39%)
Mito_carr 94..189 CDD:278578 43/94 (46%)
Solcar 2 100..187 41/86 (48%)
Solcar 3 196..279 28/87 (32%)
Mito_carr 197..283 CDD:278578 29/90 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849321
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S759
OMA 1 1.010 - - QHG51917
OrthoDB 1 1.010 - - D984118at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45618
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.770

Return to query results.
Submit another query.