DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6893 and Ucp3

DIOPT Version :9

Sequence 1:NP_001369058.1 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_037299.1 Gene:Ucp3 / 25708 RGDID:3933 Length:308 Species:Rattus norvegicus


Alignment Length:281 Identity:72/281 - (25%)
Similarity:124/281 - (44%) Gaps:20/281 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RWWSGGVAGAIAQCFTAPFDLIEARMVVIKKD--------RGMASNLQQAIRTHGFISLYDGLSA 73
            ::...|.|...|...|.|.|..:.|:.:..::        ||:...:...:||.|..|.|.||.|
  Rat    16 KFLGAGTAACFADLLTFPLDTAKVRLQIQGENPGVQSVQYRGVLGTILTMVRTEGPRSPYSGLVA 80

  Fly    74 QLLRQLTYTSMRFHLYEMGKEHLDDPAGLLDKVLVAALAGCVAGVVGT----PMELINTRMQVNR 134
            .|.||:::.|:|..||:..|:...........|.:..||||..|.:..    |.:::..|.|...
  Rat    81 GLHRQMSFASIRIGLYDSVKQFYTPKGTDHSSVAIRILAGCTTGAMAVTCAQPTDVVKVRFQAMI 145

  Fly   135 ALPKETRWNYRNVFDGLYRVTREEGFTKLYSGCFLSFMRSSLITISQNAAYDQAKQIYAEFFHMK 199
            .|.......||...|....:.||||...|:.|.:.:..|::::..::...||..|:...: .|:.
  Rat   146 RLGTGGERKYRGTMDAYRTIAREEGVRGLWKGTWPNITRNAIVNCAEMVTYDIIKEKLLD-SHLF 209

  Fly   200 HDNTLLHLISSVTAAFVCGPIIKPIE--NLRYLRMVDSRRLINSISYMMRF-GSRGP---FRGMV 258
            .||...|.:|:..|.|....:..|::  ..||:. ....|..:.:..|:|. ...||   ::|.:
  Rat   210 TDNFPCHFVSAFGAGFCATVVASPVDVVKTRYMN-APPGRYRSPLHCMLRMVAQEGPTAFYKGFM 273

  Fly   259 PYVLRMVPNTVITFLSFEQLR 279
            |..||:....|:.|:::|||:
  Rat   274 PSFLRLGSWNVMMFVTYEQLK 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6893NP_001369058.1 Mito_carr 20..96 CDD:395101 25/83 (30%)
Mito_carr 98..192 CDD:395101 23/97 (24%)
Ucp3NP_037299.1 Mito_carr 10..107 CDD:278578 25/90 (28%)
Solcar 1 11..102 25/85 (29%)
PTZ00169 13..298 CDD:240302 72/281 (26%)
Mito_carr 109..206 CDD:278578 23/97 (24%)
Solcar 2 111..202 23/90 (26%)
Mito_carr 209..299 CDD:278578 23/87 (26%)
Solcar 3 211..296 23/85 (27%)
Purine nucleotide binding. /evidence=ECO:0000250 275..297 7/20 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D984118at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.