DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6893 and SLC25A30

DIOPT Version :9

Sequence 1:NP_001369058.1 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:291 Species:Drosophila melanogaster
Sequence 2:XP_005266378.1 Gene:SLC25A30 / 253512 HGNCID:27371 Length:293 Species:Homo sapiens


Alignment Length:277 Identity:65/277 - (23%)
Similarity:118/277 - (42%) Gaps:52/277 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GGVAGAIAQCFTAPFDLIEARMVVIKKD----------RGMASNLQQAIRTHGFISLYDGLSAQL 75
            ||:|...|:|.|.|.||.:.|:.:..:.          |||...|.:..|..|..:||.|::..:
Human    12 GGLASITAECGTFPIDLTKTRLQIQGQTNDAKFKEIRYRGMLHALVRIGREEGLKALYSGIAPAM 76

  Fly    76 LRQLTYTSMRFHLYEMGK----EHLDDPAGLLDKVLVAALAGCVAGVVGTPMELINTRMQV-NRA 135
            |||.:|.:::...|:..|    |..:|.. |...|:...|:|.::..:..|.:::..|||. :..
Human    77 LRQASYGTIKIGTYQSLKRLFIER
PEDET-LPINVICGILSGVISSTIANPTDVLKIRMQAQSNT 140

  Fly   136 LPKETRWNYRNVFDGLYRVTREEGFTKLYSGCFLSFMRSSLITISQNAAYDQAKQIYAEFFHMKH 200
            :......|:.|::       ::||...|:.|..|:..|::::...:...||..|         ||
Human   141 IQGGMIGNFMNIY-------QQEGTRGLWKGVSLTAQRAAIVVGVELPVYDITK---------KH 189

  Fly   201 --------DNTLLHLISSVTAAFVCGPIIKPIENLRYLRMVDSRRLINSISYMMRFGSRGPFRGM 257
                    |....|.:||.|..........|::.:| .||::.|        ::|.|....:.|.
Human   190 LILSGLMGDTVYTHFLSSFTCGLAGALASNPVDVVR-TRMMNQR--------VLRDGRCSGYTGT 245

  Fly   258 VPYVLRMVPNTVITFLS 274
            :..:|::   ||:...|
Human   246 LDCLLQL---TVLESFS 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6893NP_001369058.1 Mito_carr 20..96 CDD:395101 26/88 (30%)
Mito_carr 98..192 CDD:395101 20/94 (21%)
SLC25A30XP_005266378.1 Mito_carr 5..100 CDD:278578 25/87 (29%)
Mito_carr 102..191 CDD:278578 22/105 (21%)
Mito_carr 199..>252 CDD:278578 13/61 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.