DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6893 and Ucp1

DIOPT Version :9

Sequence 1:NP_001369058.1 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_036814.1 Gene:Ucp1 / 24860 RGDID:3931 Length:307 Species:Rattus norvegicus


Alignment Length:303 Identity:81/303 - (26%)
Similarity:134/303 - (44%) Gaps:49/303 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TKKIRP----RWWSGGVAGAIAQCFTAPFDLIEARMVVIKKDRGMASN----------LQQAIRT 61
            |.:::|    :.:|.||:..:|...|.|.|..:.|:.:  :..|.||:          :....:|
  Rat     6 TSEVQPTMGVKIFSAGVSACLADIITFPLDTAKVRLQI--QGEGQASSTIRYKGVLGTITTLAKT 68

  Fly    62 HGFISLYDGLSAQLLRQLTYTSMRFHLYEMGKEHL----DDPAGLLDKVLVAALAGCVAGVVGTP 122
            .|...||.||.|.:.||:::.|:|..||:..:|:.    :.||.|..|:....:.|.||..:|.|
  Rat    69 EGLPKLYSGLPAGIQRQISFASLRIGLYDTVQEYFSSGRETPASLGSKISAGLMTGGVAVFIGQP 133

  Fly   123 MELINTRMQVNRAL----PKETRWNYRNVFDGLYRVTREEGFTKLYSGCFLSFMRSSLITISQNA 183
            .|::..|||....|    |:     |...::....:...|..:.|:.|...:.||:.:|..::..
  Rat   134 TEVVKVRMQAQSHLHGIKPR-----YTGTYNAYRVIATTESLSTLWKGTTPNLMRNVIINCTELV 193

  Fly   184 AYDQAKQIYAEFFHMKHDNTLLHLISSVTAAFVCGPIIKPIENLRYLRMVDSRRLINSI--SY-- 244
            .||..|..... .|:..|:...||:|::.|.|....:..|::       |...|.|||:  .|  
  Rat   194 TYDLMKGALVN-HHILADDVPCHLLSALVAGFCTTLLASPVD-------VVKTRFINSLPGQYPS 250

  Fly   245 -----MMRFGSRGP---FRGMVPYVLRMVPNTVITFLSFEQLR 279
                 |..:...||   |:|..|..||:....||.|:.||||:
  Rat   251 VPSCAMTMYTKEGPAAFFKGFAPSFLRLGSWNVIMFVCFEQLK 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6893NP_001369058.1 Mito_carr 20..96 CDD:395101 25/85 (29%)
Mito_carr 98..192 CDD:395101 25/97 (26%)
Ucp1NP_036814.1 Mito_carr 10..103 CDD:278578 26/94 (28%)
Solcar 1 11..102 25/92 (27%)
PTZ00169 21..297 CDD:240302 78/288 (27%)
Mito_carr 110..205 CDD:278578 25/100 (25%)
Solcar 2 111..201 24/94 (26%)
Solcar 3 210..295 28/91 (31%)
Mito_carr 215..300 CDD:278578 27/86 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D984118at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.