DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6893 and Ucp1

DIOPT Version :9

Sequence 1:NP_001369058.1 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_033489.1 Gene:Ucp1 / 22227 MGIID:98894 Length:307 Species:Mus musculus


Alignment Length:309 Identity:82/309 - (26%)
Similarity:136/309 - (44%) Gaps:61/309 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TKKIRP----RWWSGGVAGAIAQCFTAPFDLIEARMVVIKKDRGMASN----------LQQAIRT 61
            |.:::|    :.:|.||:..:|...|.|.|..:.|:.:  :..|.||:          :....:|
Mouse     6 TSEVQPTMGVKIFSAGVSACLADIITFPLDTAKVRLQI--QGEGQASSTIRYKGVLGTITTLAKT 68

  Fly    62 HGFISLYDGLSAQLLRQLTYTSMRFHLYEMGKEHL----DDPAGLLDKVLVAALAGCVAGVVGTP 122
            .|...||.||.|.:.||:::.|:|..||:..:|:.    :.||.|.:|:....:.|.||..:|.|
Mouse    69 EGLPKLYSGLPAGIQRQISFASLRIGLYDSVQEYFSSGRETPASLGNKISAGLMTGGVAVFIGQP 133

  Fly   123 MELINTRMQVNRAL----PKETRWNYRNVFDGLYRVTREEGFTKLYSGCFLSFMRSSLITISQNA 183
            .|::..|||....|    |:     |...::....:...|..:.|:.|...:.||:.:|..::..
Mouse   134 TEVVKVRMQAQSHLHGIKPR-----YTGTYNAYRVIATTESLSTLWKGTTPNLMRNVIINCTELV 193

  Fly   184 AYDQAK------QIYAEFFHMKHDNTLLHLISSVTAAFVCGPIIKPIENLRYLRMVDSRRLINSI 242
            .||..|      :|.|       |:...||:|::.|.|....:..|::       |...|.|||:
Mouse   194 TYDLMKGALVNNKILA-------DDVPCHLLSALVAGFCTTLLASPVD-------VVKTRFINSL 244

  Fly   243 --SY-------MMRFGSRGP---FRGMVPYVLRMVPNTVITFLSFEQLR 279
              .|       |..:...||   |:|.|...||:....||.|:.||||:
Mouse   245 PGQYPSVPSCAMSMYTKEGPTAFFKGFVASFLRLGSWNVIMFVCFEQLK 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6893NP_001369058.1 Mito_carr 20..96 CDD:395101 25/85 (29%)
Mito_carr 98..192 CDD:395101 25/103 (24%)
Ucp1NP_033489.1 Mito_carr 10..103 CDD:278578 26/94 (28%)
Solcar 1 11..102 25/92 (27%)
PTZ00169 21..297 CDD:240302 79/294 (27%)
Mito_carr 110..206 CDD:278578 25/100 (25%)
Solcar 2 111..201 24/94 (26%)
Solcar 3 210..295 28/91 (31%)
Mito_carr 215..300 CDD:278578 27/86 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D984118at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.