DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6893 and ucp-4

DIOPT Version :9

Sequence 1:NP_001369058.1 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_505414.1 Gene:ucp-4 / 179315 WormBaseID:WBGene00006729 Length:324 Species:Caenorhabditis elegans


Alignment Length:300 Identity:74/300 - (24%)
Similarity:133/300 - (44%) Gaps:36/300 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KKIRPRWWSGGVAGAIAQCFTAPFDLIEARMVVIKK---DRGMASNLQQAIRTHGFISLYDGLSA 73
            |||..:::....|..:|:..|.|.|:.:.|:.:.:.   ..||.......||..|.::|:.|::.
 Worm    21 KKIATKYFLSCTAALVAETVTYPLDITKTRLQIARNKFTKGGMVQVTYDIIRREGAMALWTGVAP 85

  Fly    74 QLLRQLTYTSMRFHLYE------MGKEHLDDPAGLLDKVLVAALAGCVAGVVGTPMELINTRMQV 132
            .:.|...||.:|...||      ..|| ::....|...:|..|.:|.:|....:|.:|:..:||:
 Worm    86 AITRHYIYTGIRMGAYEQIRLLTFNKE-VEKSFPLWKSMLCGAFSGLIAQFAASPTDLVKVQMQM 149

  Fly   133 N--RALPKETRWNYRNVFDGLYRVTREEGFTKLYSGCFLSFMRSSLITISQNAAYDQAKQIYAEF 195
            .  |.|.|:. ..|....|....:.|.:||..|:.|...:..|::|:.::..|.||..|....:.
 Worm   150 EGLRRLQKQP-LRYTGATDCFRSLYRTQGFFGLWIGWMPNCQRAALLNMADIATYDSVKHGLIDN 213

  Fly   196 FHMKHDNTLLHLISSVTAAFVCGPIIKPIENLRYLRMVDSRR----------------LINSI-- 242
            |.:| ||.|.|.::|..|......:..|.:.:: .||:|..|                |...:  
 Worm   214 FELK-DNWLTHAVASACAGLAAAIVSLPSDVVK-TRMMDQIRHELDAKMMHKKNTHVDLYKGVVD 276

  Fly   243 SYMMRFGSRGPF---RGMVPYVLRMVPNTVITFLSFEQLR 279
            .|:....:.|.|   :|.:|..:||.|.::..::|:|::|
 Worm   277 CYIKIIKNEGFFSLYKGFLPSYIRMAPWSLTFWVSYEEIR 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6893NP_001369058.1 Mito_carr 20..96 CDD:395101 21/84 (25%)
Mito_carr 98..192 CDD:395101 25/95 (26%)
ucp-4NP_505414.1 PTZ00169 20..317 CDD:240302 73/299 (24%)
Mito_carr 22..111 CDD:278578 21/88 (24%)
Mito_carr 115..214 CDD:278578 25/99 (25%)
Mito_carr <240..318 CDD:278578 16/77 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.