DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6893 and misc-1

DIOPT Version :9

Sequence 1:NP_001369058.1 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_493694.2 Gene:misc-1 / 173414 WormBaseID:WBGene00015186 Length:306 Species:Caenorhabditis elegans


Alignment Length:295 Identity:88/295 - (29%)
Similarity:133/295 - (45%) Gaps:44/295 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GGVAGAIAQCFTAPFDLIEARMVVI-----KKDRGMASNLQQAIRTHGFISLYDGLSAQLLRQLT 80
            ||.||..|.....|.||::.||.:.     |:.|.....|...::..|..::|:||||.||||.|
 Worm    16 GGTAGMGATLVVQPLDLVKNRMQLSGTTGKKEYRSSMHALTSIMKNEGVFAVYNGLSAGLLRQAT 80

  Fly    81 YTSMRFHLYEMGKEHL---DDPAGLLDKVLVAALAGCVAGVVGTPMELINTRMQVNRALPKETRW 142
            ||:.|...|....|..   |.|.....|.::...||.:...||||.|:...||..:..||.|.|.
 Worm    81 YTTTRLGTYAFLLERFTEK
DKPLSFGMKAVLGMTAGGIGSFVGTPAEIALIRMTGDGRLPVEQRR 145

  Fly   143 NYRNVFDGLYRVTREEGFTKLYSGCFLSFMRSSLITISQNAAYDQAKQ-----------IYAEFF 196
            ||..|.:.|.|:|:|||...|:.||..:.:|:.::..:|.|.|.||||           |:..| 
 Worm   146 NYTGVVNALTRITKEEGVLTLWRGCTPTVLRAMVVNAAQLATYSQAKQALLASGKVQDGIFCHF- 209

  Fly   197 HMKHDNTLLHLISSVTAAFVCGPIIKPIENLRYLRMVDSRRLINSISYMMRFGSRGP-------- 253
                   |..:||.:.......|:......::.::::|.:.     .|...|...|.        
 Worm   210 -------LASMISGLATTIASMPVDIAKTRIQSMKVIDGKP-----EYKNAFDVWGKVIKNEGIF 262

  Fly   254 --FRGMVPYVLRMVPNTVITFLSFEQLRVNFGYIE 286
              ::|..||.:|:.|:||:||:..||:  |..|.:
 Worm   263 ALWKGFTPYYMRLGPHTVLTFIILEQM--NAAYFQ 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6893NP_001369058.1 Mito_carr 20..96 CDD:395101 29/79 (37%)
Mito_carr 98..192 CDD:395101 35/104 (34%)
misc-1NP_493694.2 Mito_carr 7..99 CDD:278578 29/82 (35%)
Mito_carr 101..196 CDD:278578 35/94 (37%)
Mito_carr 202..296 CDD:278578 23/109 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D404074at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.