DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6893 and Slc25a10

DIOPT Version :9

Sequence 1:NP_001369058.1 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_596909.1 Gene:Slc25a10 / 170943 RGDID:621430 Length:286 Species:Rattus norvegicus


Alignment Length:283 Identity:108/283 - (38%)
Similarity:166/283 - (58%) Gaps:25/283 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RWWSGGVAGAIAQCFTAPFDLIEARMVVIKKDR----GMASNLQQAIRTHGFISLYDGLSAQLLR 77
            ||:.||:|...|.|.|.|.||::..:...::.:    |||   .|.:||.||::||:||||.|.|
  Rat     8 RWYFGGLASCGAACCTHPLDLLKVHLQTQQEVKLRMTGMA---LQVVRTDGFLALYNGLSASLCR 69

  Fly    78 QLTYTSMRFHLYEMGKEHL----DDPAGLLDKVLVAALAGCVAGVVGTPMELINTRMQVNRALPK 138
            |:||:..||.:||..::::    ..|.....|||:..::|...|.||||.:|:|.|||.:..||.
  Rat    70 QMTYSLTRFAIYETMRDYMTKDSQGPLPFYSKVLLGGISGLTGGFVGTPADLVNVRMQNDMKLPL 134

  Fly   139 ETRWNYRNVFDGLYRVTREEGFTKLYSGCFLSFMRSSLITISQNAAYDQAKQIYAEFFHMKHDNT 203
            ..|.||.:..||||||.||||..||:||..::..|.:|:|:.|.:.||||||:.....::. ||.
  Rat   135 SQRRNYSHALDGLYRVAREEGLKKLFSGATMASSRGALVTVGQLSCYDQAKQLVLSTGYLS-DNI 198

  Fly   204 LLHLISSV----TAAFVCGPIIKPIENLRYLRMVDSRRLINSISY----MMRFGSRGPFRGMVPY 260
            ..|.:||.    .|.|:|    :|::.|: .|:::|:.....:.:    ..:.|.:..|:|:||.
  Rat   199 FTHFLSSFIAGGCATFLC----QPLDVLK-TRLMNSKGEYQGVFHCAVETAKLGPQAFFKGLVPA 258

  Fly   261 VLRMVPNTVITFLSFEQLRVNFG 283
            .:|:||:||:||:..||||.:||
  Rat   259 GVRLVPHTVLTFMFLEQLRKHFG 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6893NP_001369058.1 Mito_carr 20..96 CDD:395101 32/79 (41%)
Mito_carr 98..192 CDD:395101 44/93 (47%)
Slc25a10NP_596909.1 Mito_carr 12..92 CDD:395101 32/82 (39%)
Mito_carr 94..189 CDD:395101 44/94 (47%)
Mito_carr 197..283 CDD:395101 29/90 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352936
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG51917
OrthoDB 1 1.010 - - D404074at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45618
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.820

Return to query results.
Submit another query.