DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6893 and SLC25A10

DIOPT Version :9

Sequence 1:NP_001369058.1 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_001257882.1 Gene:SLC25A10 / 1468 HGNCID:10980 Length:406 Species:Homo sapiens


Alignment Length:173 Identity:69/173 - (39%)
Similarity:104/173 - (60%) Gaps:11/173 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RWWSGGVAGAIAQCFTAPFDLIEARMVVIKKDR----GMASNLQQAIRTHGFISLYDGLSAQLLR 77
            ||:.||:|...|.|.|.|.||::..:...::.:    |||   .:.:||.|.::||.||||.|.|
Human     9 RWYFGGLASCGAACCTHPLDLLKVHLQTQQEVKLRMTGMA---LRVVRTDGILALYSGLSASLCR 70

  Fly    78 QLTYTSMRFHLYEMGKEHL----DDPAGLLDKVLVAALAGCVAGVVGTPMELINTRMQVNRALPK 138
            |:||:..||.:||..::.:    ..|....:|||:.:::|...|.||||.:|:|.|||.:..||:
Human    71 QMTYSLTRFAIYETVRDRVAKGSQGPLPFHEKVLLGSVSGLAGGFVGTPADLVNVRMQNDVKLPQ 135

  Fly   139 ETRWNYRNVFDGLYRVTREEGFTKLYSGCFLSFMRSSLITISQ 181
            ..|.||.:..||||||.||||..:|:||..::..|.:|:|:.|
Human   136 GQRRNYAHALDGLYRVAREEGLRRLFSGATMASSRGALVTVGQ 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6893NP_001369058.1 Mito_carr 20..96 CDD:395101 30/79 (38%)
Mito_carr 98..192 CDD:395101 37/84 (44%)
SLC25A10NP_001257882.1 Mito_carr 13..93 CDD:278578 30/82 (37%)
Mito_carr 95..179 CDD:278578 37/84 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158939
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S759
OMA 1 1.010 - - QHG51917
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45618
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.760

Return to query results.
Submit another query.