DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6893 and ucp1

DIOPT Version :9

Sequence 1:NP_001369058.1 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_001107354.1 Gene:ucp1 / 100135179 XenbaseID:XB-GENE-963773 Length:309 Species:Xenopus tropicalis


Alignment Length:302 Identity:79/302 - (26%)
Similarity:133/302 - (44%) Gaps:41/302 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IKTKKIRP----RWWSGGVAGAIAQCFTAPFDLIEARMVVIKKD-----------RGMASNLQQA 58
            :|...:.|    ::.:.|.|..||..||.|.|..:.|:.:..:.           :|:...:...
 Frog     4 LKPSDVPPTPAVKFIAAGTAACIADLFTFPLDTAKVRLQIQGETTGSGAANGIRYKGVFGTISTI 68

  Fly    59 IRTHGFISLYDGLSAQLLRQLTYTSMRFHLYEM-------GKEHLDDPAGLLDKVLVAALAGCVA 116
            ::|.|..|||:||.|.|.||:::.|:|..||:.       |||    .||:..::|.....|.:|
 Frog    69 VKTEGPKSLYNGLVAGLQRQMSFASIRIGLYDTVKLFYTNGKE----KAGIGSRILAGCTTGALA 129

  Fly   117 GVVGTPMELINTRMQVNRALPKETRWNYRNVFDGLYRVTREEGFTKLYSGCFLSFMRSSLITISQ 181
            ..|..|.:::..|.|....|....| .|....|....:.::||...|:.|.|.:..|::::..::
 Frog   130 VTVAQPTDVVKVRFQAQANLQGVKR-RYNGTMDAYKTIAKKEGVRGLWKGTFPNVTRNAIVNCTE 193

  Fly   182 NAAYDQAKQIYAEFFHMK--HDNTLLHLISSVTAAFVCGPIIKPIE--NLRYLRMVDS--RRLIN 240
            ...||..|:   ...|.|  .||...|.:|:..|.|....|..|::  ..||:.....  :..:|
 Frog   194 LVTYDVIKE---NLLHYKLMTDNLPCHFVSAFGAGFCTTVIASPVDVVKTRYMNSPPGQYKSALN 255

  Fly   241 SISYMMRFGSRGP---FRGMVPYVLRMVPNTVITFLSFEQLR 279
            ....|:.  ..||   ::|.||..||:....|:.|:|:|||:
 Frog   256 CAWTMIT--KEGPTAFYKGFVPSFLRLGSWNVVMFVSYEQLK 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6893NP_001369058.1 Mito_carr 20..96 CDD:395101 28/93 (30%)
Mito_carr 98..192 CDD:395101 22/93 (24%)
ucp1NP_001107354.1 Mito_carr 10..110 CDD:278578 26/99 (26%)
PTZ00169 14..299 CDD:240302 77/292 (26%)
Mito_carr 111..208 CDD:278578 24/104 (23%)
Mito_carr 211..302 CDD:278578 25/87 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D984118at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.