DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp12c1 and CYP71B38

DIOPT Version :9

Sequence 1:NP_001287109.1 Gene:Cyp12c1 / 40037 FlyBaseID:FBgn0036806 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_190011.1 Gene:CYP71B38 / 823550 AraportID:AT3G44250 Length:499 Species:Arabidopsis thaliana


Alignment Length:514 Identity:118/514 - (22%)
Similarity:185/514 - (35%) Gaps:149/514 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 PGPTRWQLFRGFQKGGEYHQLGMDDVMRLYKKQFGDICLIPGLFGMPSTVFTFNVETFEKVYRTE 109
            |||.      |....|..||||    ..|||                         :|.|:.:..
plant    30 PGPI------GLPIIGNLHQLG----KLLYK-------------------------SFHKISQEY 59

  Fly   110 GQWPV---RGGAEPVIHYRNKRKDEFFKNCMGLFGNGAEWGKNRSAVNPVLMQHRNVAIYLKPMQ 171
            |  ||   |.|..|||...:|              .|||         .||..| ::....:|..
plant    60 G--PVVLLRLGVVPVIVVSSK--------------EGAE---------EVLKTH-DLETCTRPKT 98

  Fly   172 RVNRQFVNRIREIRDKESQEVP-GDFMNTINHLTFESVATVALDRELGLLREANPPPEASKLFKN 235
            .....|....::|     ...| ||....:..:|...:.:|...:....:||........|:.|:
plant    99 AATGLFTYNFKDI-----GFAPFGDDWREMRKITTLELFSVKKLKSFRYIREEESELLVKKISKS 158

  Fly   236 IEVLMDSFFDLGVRPSLYRYIPTPTYKKFSR-AMDEIFDTCSMYVNQAIER-------------- 285
            ::...:|..||  |..|:.:    |.....| |..:.|..|. :|:.::|.              
plant   159 VDETQNSSVDL--RKVLFSF----TASIICRLAFGQNFHQCD-FVDASLEELVLESEANLGTFAF 216

  Fly   286 ---------IDRKSSQ-------------------------GDSNDHKSVLEQLLQIDRK----- 311
                     |||.|.|                         |...||..::..:|.:..|     
plant   217 ADFFPGGWLIDRISGQHSRVNKAFYKLTNFYKHVIDDHLKTGQPQDHSDIVSVMLDMINKPTKAD 281

  Fly   312 --------LAVVMAMDMLMGGVDTTSTAISGILLNLAKNPEKQQRLREEVLSKLTSLHSEFTVED 368
                    |..||: |:.:.||:..:..:...|..|:::|...::|:||:.:.|.......|.||
plant   282 SFKVTYDHLKGVMS-DIFLAGVNGGANTMIWTLTELSRHPRVMKKLQEEIRAMLGPNKERITEED 345

  Fly   369 MKSLPYLRAVIKESLRLY-PVTFGNARSAGADVVLDGYRIPKGTKLLMTNSFLLKDDRLYPRAKE 432
            ::.:.||:.|:.|:.||: |......|...:|:.:.||.|||.|.:.:....:.:|.:.:.:..|
plant   346 LEKVEYLKLVMVETFRLHPPAPLLLPRLTMSDIKIQGYNIPKNTMIQINTYAIGRDPKYWKQPGE 410

  Fly   433 FIPERWLRRKDDDKSDVLMNKDLNAFIYLPFGFGPRMCVGKRIVDLEMELTVANLVRNF 491
            |||||:|....|.|.        ..|..||||.|.|:|.|.......:||.:.||:..|
plant   411 FIPERFLDSPIDYKG--------QHFELLPFGAGRRICPGMATGITMVELGLLNLLYFF 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp12c1NP_001287109.1 p450 45..502 CDD:278495 118/514 (23%)
CYP71B38NP_190011.1 p450 27..497 CDD:386267 118/514 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D871849at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.