DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp12c1 and CYP90D1

DIOPT Version :9

Sequence 1:NP_001287109.1 Gene:Cyp12c1 / 40037 FlyBaseID:FBgn0036806 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_566462.1 Gene:CYP90D1 / 820582 AraportID:AT3G13730 Length:491 Species:Arabidopsis thaliana


Alignment Length:348 Identity:90/348 - (25%)
Similarity:141/348 - (40%) Gaps:49/348 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 HRNVAIYLK-PM--QRVNRQFVNRIREIRDKESQEVPGDFMNTINHLTFESVATVALDRELGLLR 221
            |..|..:|| |:  .::.|.....:.|..|..|::.|....:....:.|:.:|...:..|.|   
plant   149 HGLVGSFLKSPLLKAQIVRDMHKFLSESMDLWSEDQPVLLQDVSKTVAFKVLAKALISVEKG--- 210

  Fly   222 EANPPPEASKLFKNIEVLMDSFFDLGVR-PSLYRYIPTPTYKKFSRAMDEIFDTCSMYVNQAIER 285
                 .:..:|.:..|..:.....|.:. |....:......|...:.::.|           ||.
plant   211 -----EDLEELKREFENFISGLMSLPINFPGTQLHRSLQAKKNMVKQVERI-----------IEG 259

  Fly   286 IDRKSSQGDSND--HKSVLEQLLQ-----IDRKLAVVMAMDMLMGGVDTTSTAISGILLNLAKNP 343
            ..||:...:.:|  .|.|::.||:     :...|.....:||::.|.|:....|:..:..|:.:|
plant   260 KIRKTKNKEEDDVIAKDVVDVLLKDSSEHLTHNLIANNMIDMMIPGHDSVPVLITLAVKFLSDSP 324

  Fly   344 EKQQRLREEVLSKLTSLHSEFTVE-----DMKSLPYLRAVIKESLRLYPVTFGNARSAGADVVLD 403
            .....|.||.: ||.|| .|.|.|     |..|||:.:.||.|:||:..|..|..|.|..||.:.
plant   325 AALNLLTEENM-KLKSL-KELTGEPLYWNDYLSLPFTQKVITETLRMGNVIIGVMRKAMKDVEIK 387

  Fly   404 GYRIPKGTKLLMTNSFLLKDDRLYPRAKEFIPERWLRRKDDDKSDVLMNKDLNAFIYLPFGFGPR 468
            ||.||||...|.....:..|...|....:|.|.||..|            |:|...:.|||.|.|
plant   388 GYVIPKGWCFLAYLRSVHLDKLYYESPYKFNPWRWQER------------DMNTSSFSPFGGGQR 440

  Fly   469 MCVGKRIVDLEMELTVANLVRNF 491
            :|.|..:..||..:.:.:||..|
plant   441 LCPGLDLARLETSVFLHHLVTRF 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp12c1NP_001287109.1 p450 45..502 CDD:278495 90/348 (26%)
CYP90D1NP_566462.1 PLN03141 44..491 CDD:215600 90/348 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D871849at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.