DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp12c1 and CYP712A1

DIOPT Version :9

Sequence 1:NP_001287109.1 Gene:Cyp12c1 / 40037 FlyBaseID:FBgn0036806 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_181754.1 Gene:CYP712A1 / 818826 AraportID:AT2G42250 Length:514 Species:Arabidopsis thaliana


Alignment Length:524 Identity:114/524 - (21%)
Similarity:207/524 - (39%) Gaps:100/524 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLRLTVKHGLRANSQLAATRNPDASSYVQQLESEWEGAKPFTELPGPTRWQLFRGFQKGGEYHQL 65
            ||....|..|:....||||:.|.:..           |.||.                 |..|.:
plant    21 MLYALFKWFLKEQGSLAATKLPQSPP-----------ALPFI-----------------GHLHLI 57

  Fly    66 G--MDDVMRLYKKQFGDICLIPGLFGMPSTVFTFNVETFEKVYRTEGQWPVRGGAEPVIHYRNKR 128
            |  :....:....::|.:..|  ..|....|...:.....::::           |..:::.::.
plant    58 GKVLPVSFQSLAHKYGPLMEI--RLGASKCVVVSSSSVAREIFK-----------EQELNFSSRP 109

  Fly   129 KDEFFKNCMGLFGNGAEWGKNRSAVNPVLMQHRNVAIYLKPMQRVNRQFVNRIREIRDKESQE-- 191
            :          ||: ||:.|.|.: ..||.|:.:...::|.:.......|.::.:..|...:|  
plant   110 E----------FGS-AEYFKYRGS-RFVLAQYGDYWRFMKKLCMTKLLAVPQLEKFADIREEEKL 162

  Fly   192 -------------VPGDFMNTINHLTFESVATVALD-RELGLLREANPPPEASKLFKNIEVLMDS 242
                         :|.|..:.....|...:..:|:. |..|...||          :.|..|:..
plant   163 KLVDSVAKCCREGLPCDLSSQFIKYTNNVICRMAMSTRCSGTDNEA----------EEIRELVKK 217

  Fly   243 FFDLGVRPSLYRYIPTPTYKKFS---RAMDEIFDTCSMYVNQAIERIDRKSSQGDSNDHKSVLEQ 304
            ..:|..:.|:...:.......||   :.:..:.:...:.|.:.::..:.|:.:.|.. .|.:|:.
plant   218 SLELAGKISVGDVLGPLKVMDFSGNGKKLVAVMEKYDLLVERIMKEREAKAKKKDGT-RKDILDI 281

  Fly   305 LLQIDRKLAVVM----------AMDMLMGGVDTTSTAISGILLNLAKNPEKQQRLREEVLSKLTS 359
            ||:..|.....|          .:|:.|.|.||::.|:...:..|..:|:...:||||:.:.:.|
plant   282 LLETYRDPTAEMKITRNDMKSFLLDVFMAGTDTSAAAMQWAMGQLINHPQAFNKLREEINNVVGS 346

  Fly   360 --LHSEFTVEDMKSLPYLRAVIKESLRLYPVTFGNARSAGADVVLDGYRIPKGTKLLMTNSFLLK 422
              |..|   .|:.:|||||||::|:|||:|......|....|..::|..:...|::|:....:::
plant   347 KRLVKE---SDVPNLPYLRAVLRETLRLHPSAPLIIRECAEDCQVNGCLVKSKTRVLVNVYAIMR 408

  Fly   423 DDRLYPRAKEFIPERWLRRKDDDKSDVLMNKDLNAFIYLPFGFGPRMCVGKRIVDLEMELTVANL 487
            |..|:..|..|||||:|...::...:..|......|.|||||.|.|.|.|..:....|.:.|.:|
plant   409 DSELWADADRFIPERFLESSEEKIGEHQMQFKGQNFRYLPFGSGRRGCPGASLAMNVMHIGVGSL 473

  Fly   488 VRNF 491
            |:.|
plant   474 VQRF 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp12c1NP_001287109.1 p450 45..502 CDD:278495 102/480 (21%)
CYP712A1NP_181754.1 p450 9..508 CDD:299894 114/524 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.