DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp12c1 and AT2G12190

DIOPT Version :9

Sequence 1:NP_001287109.1 Gene:Cyp12c1 / 40037 FlyBaseID:FBgn0036806 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_178922.1 Gene:AT2G12190 / 815688 AraportID:AT2G12190 Length:512 Species:Arabidopsis thaliana


Alignment Length:406 Identity:108/406 - (26%)
Similarity:181/406 - (44%) Gaps:63/406 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 GAEWGKNRSAVNPVLMQHRNVAIYLKPMQRVNRQFVNRIREIRDKESQEVPGDFMNTINHLTFES 207
            ||.|...|..:...::....|..|....:.|.....:|..:.|.:|...|       ::||.:..
plant   125 GATWRLLRRNLTSEILHPSRVRSYSHARRWVLEILFDRFGKSRGEEPIVV-------VDHLHYAM 182

  Fly   208 VATVAL----DRELGLLREANPPPEASKLFKNIEVL-------MDSFFDLGVRPSLYRYIPTPTY 261
            .|.:.|    |:    |.|        |..|.:|.:       ...|..|.:.|...:.|....:
plant   183 FALLVLMCFGDK----LDE--------KQIKQVEYVQRRQLLGFSRFNILNLWPKFTKLILRKRW 235

  Fly   262 KKFSRAMDEIFDTCSMYV---NQAIERIDRKSSQGDSNDHK----SVLEQLLQID-----RKL-- 312
            ::|.:...|..|.....:   .:.:|....:||: :..|:|    |.::.||:::     |||  
plant   236 EEFFQMRREQHDVLLPLIRARRKIVEERKNRSSE-EEEDNKVYVQSYVDTLLELELPDEKRKLNE 299

  Fly   313 --AVVMAMDMLMGGVDTTSTAISGILLNLAKNPEKQQRLREEVLSKLTSLHSEFTVEDMKSLPYL 375
              .|.:..:.|.||.|||:||:..|:.||.||||.|:||.||:.|.:.....|...||.:.:|||
plant   300 DEIVSLCSEFLNGGTDTTATALQWIMANLVKNPEIQKRLYEEIKSVVGEEAKEVEEEDAQKMPYL 364

  Fly   376 RAVIKESLRLYPV-TFGNARSAGADVVLDGYRIPKGTKLLMTNSFLLKDDRLYPRAKEFIPERWL 439
            :||:.|.||.:|. .|....|...|.||.||::||...:....:.:.:|..::.....|.|||::
plant   365 KAVVMEGLRRHPPGHFVLPHSVTEDTVLGGYKVPKKGTINFMVAEIGRDPMVWEEPMAFKPERFM 429

  Fly   440 RRKDDDKSDVLMNKDLNAFIYLPFGFGPRMCVGKRIVDLEMELTVANLVRNFHIEYNYSTEKPYK 504
              .:::..|:..::.:.   .:|||.|.|:|.|..:..|.:|..|||:||.|.          :|
plant   430 --GEEEAVDITGSRGIK---MMPFGAGRRICPGIGLAMLHLEYYVANMVREFE----------WK 479

  Fly   505 CRFLYKPNIPLKFKFT 520
            ....::.::..||:||
plant   480 EVQGHEVDLTEKFEFT 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp12c1NP_001287109.1 p450 45..502 CDD:278495 103/386 (27%)
AT2G12190NP_178922.1 PLN00168 23..512 CDD:215086 108/406 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D871849at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.