DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp12c1 and Cyp313a1

DIOPT Version :9

Sequence 1:NP_001287109.1 Gene:Cyp12c1 / 40037 FlyBaseID:FBgn0036806 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_650368.1 Gene:Cyp313a1 / 41759 FlyBaseID:FBgn0038236 Length:492 Species:Drosophila melanogaster


Alignment Length:489 Identity:110/489 - (22%)
Similarity:192/489 - (39%) Gaps:97/489 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 IPGLFGMPSTVFTF-NVETFEK--VYRTE-------------GQWPVRGGAEPVI---------- 122
            |||..|:|....:. |:.|:::  .:||:             |..|.....:|.:          
  Fly    32 IPGPIGLPILGSSLENIITYKRKLSFRTKYLNKYGSTILTWMGPVPFIVTRDPKVVEDIFSSPDC 96

  Fly   123 HYRNKRKDEFFKNCM--GLFG-NGAEWGKNRSAVNPVLMQHRNVAIYLKPMQRVNRQFVNRIREI 184
            |.:::.......:||  ||.| ....|...|...||...|...:: :........:..:|.:...
  Fly    97 HNKSQHIVNAITSCMGNGLLGKQDPHWLDRRKHFNPSFKQDLLLS-FFHIFDAETKVLMNLLDTY 160

  Fly   185 RDKESQEVPGDFMNTINHLTFESVATVALDRELGLLREANPPPEASKLFKNIEVLMDSFFDLGVR 249
            .||...:|..:.:    ..:|:..|...:..|:          :..:.||| ..|::||..|...
  Fly   161 VDKGEIDVVPEML----RWSFKIAAQTTMGSEV----------KHDEHFKN-GSLVESFESLISH 210

  Fly   250 PSL-----------------YRYIPTPTYKKFSRAMDEIFDTCSMYVNQAIERIDRKSSQGDSND 297
            .:|                 |..:....:.:..:.:|.:       ||:.:..:.:..|..:|| 
  Fly   211 STLNILMPLVQNRMISKICGYDKLRADNFSRIQKMLDNV-------VNKKVNPLPKTDSDPESN- 267

  Fly   298 HKSVLEQLLQIDRKLAVVMAMD-------MLMGGVDTTSTAISGILLNLAKNPEKQQRLREEVLS 355
              .|:.:.:::.|| ..:..||       |:..|.||::..:...|..||.:||.|:.:.||:..
  Fly   268 --IVINRAMELYRK-GDITYMDVKSECCIMIAAGYDTSALTVYHALFLLANHPEHQEAVFEELNG 329

  Fly   356 KLTSL-HSEFTVEDMKSLPYLRAVIKESLRLYPVTFGNARSAGADVVL-DGYRIPKGTKLLMTNS 418
            ..... |...|..||:.|.||..||||:|||.|.....||....||.| :|..||||..:.:...
  Fly   330 VFPDAGHFGITYPDMQKLDYLERVIKETLRLIPAIPITARETKNDVRLSNGVLIPKGVVIGIDMF 394

  Fly   419 FLLKDDRLY-PRAKEFIPERWLRRKDDDKSDVLMNKDLNAFIYLPFGFGPRMCVGKRIVDLEMEL 482
            ...::..:: |.|..|.|:.:|....:.|         :.:.|:||..|.|.|:|.:...:..:.
  Fly   395 HTHRNPEVWGPDADNFNPDNFLAENMEQK---------HPYAYIPFARGKRNCIGSKYAMMSSKF 450

  Fly   483 TVANLVRNFHIEYNYSTEKPYKCRFLYKPNIPLK 516
            .:..::||    |..||...|| ..:|..|:.:|
  Fly   451 ALCRILRN----YKISTSTLYK-DLVYVDNMTMK 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp12c1NP_001287109.1 p450 45..502 CDD:278495 105/473 (22%)
Cyp313a1NP_650368.1 p450 33..463 CDD:299894 102/469 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442747
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24305
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.