DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp12c1 and Cyp26b1

DIOPT Version :9

Sequence 1:NP_001287109.1 Gene:Cyp12c1 / 40037 FlyBaseID:FBgn0036806 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_851601.2 Gene:Cyp26b1 / 312495 RGDID:631379 Length:512 Species:Rattus norvegicus


Alignment Length:525 Identity:122/525 - (23%)
Similarity:200/525 - (38%) Gaps:125/525 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LRANSQL-----AATRNPDASSYVQQLESEWEGAKPFTELPGPTRWQL-FRGFQKGGEYHQLGMD 68
            |..:.||     ||||:......:.      :|:..|..:.....|.| ..|||..         
  Rat    26 LAVSQQLWQLRWAATRDKSCKLPIP------KGSMGFPLIGETGHWLLQGSGFQSS--------- 75

  Fly    69 DVMRLYKKQFGDICLIPGLFGMPSTVFTFNVETFEKVYRTEGQ-----WP----VRGGAEPVIH- 123
                 .::::|:: ....|.|.|....| ..|...|:...|.|     ||    |..|...|.: 
  Rat    76 -----RREKYGNV-FKTHLLGRPLIRVT-GAENVRKILLGEHQLVSTEWPRSARVLLGPNTVANS 133

  Fly   124 ----YRNKRKDEFFKNCMGLFGNGAEWGKNRSAVNPVLMQHRNVAIYLKPMQRVNRQFVNRIREI 184
                :|||||                       |...:..|..:..||..:|.|.:.      .:
  Rat   134 IGDIHRNKRK-----------------------VFSKIFSHEALESYLPKIQLVIQD------TL 169

  Fly   185 RDKESQEVPGDFMNTINHLTFESVATVALDRELGLLREANPPPEASKLFKNIEVLMDSFFDLGVR 249
            |...||....:.......|||.....|       ||..:.|..:...||:..:..:::.|.|.|.
  Rat   170 RAWSSQPEAINVYQEAQRLTFRMAVRV-------LLGFSIPEEDLGNLFEVYQQFVENVFSLPVD 227

  Fly   250 PSLYRYIPTPTYKKFSRAMDEIFDTCSMYVNQAIERIDRKSSQ-GDSNDHKSVLEQLLQIDRKLA 313
                  :|...|::..:|        ...:.:.:|:..|:..| ....|:...|:.|::..::..
  Rat   228 ------LPFSGYRRGIQA--------RQILQKGLEKAIREKLQCTQGKDYSDALDILIESSKEHG 278

  Fly   314 VVMAMDMLMGGV--------DTTSTAISGILLNLAKNPEKQQRLREEVLSKLTSLHS-----EFT 365
            ..|.|..|..|.        .||::|.:.:::.|.|:|...::||||:.:: ..||.     |.|
  Rat   279 KEMTMQELKDGTLELIFAAYATTASASTSLIMQLLKHPAVLEKLREELRAQ-GLLHGGGCPCEGT 342

  Fly   366 VE-DMKS-LPYLRAVIKESLRLYPVTFGNARSAGADVVLDGYRIPKGTKLLMTNSFLLKDDR--- 425
            :. ||.| |.||..||||.:||:....|..|:......|||::||||..::    :.::|..   
  Rat   343 LRLDMLSGLRYLDCVIKEVMRLFTPVSGGYRTVLQTFELDGFQIPKGWSVM----YSIRDTHDTA 403

  Fly   426 -LYPRAKEFIPERWLRRKDDDKSDVLMNKDLNAFIYLPFGFGPRMCVGKRIVDLEMELTVANLVR 489
             ::.....|.|:|:.:.:.:||.        ..|.|||||.|.|.|:||.:..|.:::....|..
  Rat   404 PVFKDVNVFDPDRFSQARSEDKD--------GRFHYLPFGGGVRTCLGKHLAKLFLKVLAVELAS 460

  Fly   490 NFHIE 494
            ....|
  Rat   461 TSRFE 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp12c1NP_001287109.1 p450 45..502 CDD:278495 113/485 (23%)
Cyp26b1NP_851601.2 CYP26B1 60..490 CDD:410730 113/485 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D871849at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.