DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp12c1 and Cyp11b2

DIOPT Version :9

Sequence 1:NP_001287109.1 Gene:Cyp12c1 / 40037 FlyBaseID:FBgn0036806 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_034121.4 Gene:Cyp11b2 / 13072 MGIID:88584 Length:500 Species:Mus musculus


Alignment Length:497 Identity:138/497 - (27%)
Similarity:232/497 - (46%) Gaps:66/497 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 KPFTELPGPTR--W----QLFRGFQKGGEYHQLGMDDVMR----LYKKQFGDICLIPGLFGMPST 93
            :||..:|..:|  |    |:.|  ::|.|...|.|..|.|    :::...|...::..:  :|  
Mouse    36 QPFEAIPQYSRNKWLKMIQILR--EQGQENLHLEMHQVFRELGPIFRHSVGKTQIVSVM--LP-- 94

  Fly    94 VFTFNVETFEKVYRTEGQWPVRGGAEPVIHYRNKRKDEFFKNCMGL-----FGNGAEWGKNRSAV 153
                  |..||:::.|...|.|...||.:.:|..|         ||     ..||.||..||..:
Mouse    95 ------EDAEKLHQVESMLPRRMHLEPWVAHRELR---------GLRRGVFLLNGPEWRLNRLRL 144

  Fly   154 NPVLMQHRNVAIYLKPMQRVNRQFVNRIREIRDKESQEVPG----DFMNTINHLTFESVATVALD 214
            |..::..:.|..::..:..|.|.|:..::|   |..|...|    |...::.:.|.|:.......
Mouse   145 NRNVLSPKAVQKFVPMVDMVARDFLETLKE---KVLQNARGSLTMDVQQSLFNYTIEASNFALFG 206

  Fly   215 RELGLLREANPPPEASKLFKNIEVLMDSFFDLGVRP-SLYRYIPTPTYKKFSRAMDEIFDTCSMY 278
            ..||||.. :..|.:.|....:..:..|...|...| ||.|:..|..:|:...|.|.|    |.|
Mouse   207 ERLGLLGH-DLSPGSLKFIHALHSMFKSTSQLLFLPKSLTRWTSTRVWKEHFDAWDVI----SEY 266

  Fly   279 VNQAIERIDRKSSQGDSNDHKSVLEQLL-QIDRKLAVVMA--MDMLMGGVDTTSTAISGILLNLA 340
            .|:.|.::.::...|.|..:..::.:|: |....|..:.|  |::..|.||||:..:...|..||
Mouse   267 ANRCIWKVHQELRLGSSQTYSGIVAELISQGSLPLDAIKANSMELTAGSVDTTAIPLVMTLFELA 331

  Fly   341 KNPEKQQRLREEVLSKLTSLHSEFTVEDMKSLPYLRAVIKESLRLYPVTFGNARSAGADVVLDGY 405
            :||:.|:.||:|.|:...|:.:. ..:.|..||.|||.:||:||||||.....|...:|:||..|
Mouse   332 RNPDVQKALRQESLAAEASIAAN-PQKAMSDLPLLRAALKETLRLYPVGGFLERILSSDLVLQNY 395

  Fly   406 RIPKGTKLLMTNSFLLKDDRLYPRAKEFIPERWLRRKDDDKSDVLMNKDLNAFIYLPFGFGPRMC 470
            .:|.||.:|:....:.::..::||.:.::|:|||.||             .:|.:|.||||.|.|
Mouse   396 HVPAGTLVLLYLYSMGRNPAVFPRPERYMPQRWLERK-------------RSFQHLAFGFGVRQC 447

  Fly   471 VGKRIVDLEMELTVANLVRNFHIEYNYSTEKPYKCRFLYKPN 512
            :|:|:.::||.|.:.::::.|.:|.....:.....||:..|:
Mouse   448 LGRRLAEVEMMLLLHHILKTFQVETLRQEDVQMAYRFVLMPS 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp12c1NP_001287109.1 p450 45..502 CDD:278495 133/479 (28%)
Cyp11b2NP_034121.4 p450 42..496 CDD:365848 136/491 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D185685at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8705
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.