DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chmp1 and DID4

DIOPT Version :9

Sequence 1:NP_001287108.1 Gene:Chmp1 / 40036 FlyBaseID:FBgn0036805 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_012924.2 Gene:DID4 / 853868 SGDID:S000001485 Length:232 Species:Saccharomyces cerevisiae


Alignment Length:213 Identity:50/213 - (23%)
Similarity:108/213 - (50%) Gaps:17/213 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 MEKHLFNLKFAVKELERNSKKCEKEEKLEKAKAKKAIQKGNMDVARIHAENAIRQKNQAVNYLRM 70
            ::|:...|:...:||||..:|.|.::|...::.||:.:.|.:..|::.|::.:|.:|....:..|
Yeast    18 LKKNQRALERTQRELEREKRKLELQDKKLVSEIKKSAKNGQVAAAKVQAKDLVRTRNYIQKFDNM 82

  Fly    71 SARVDAVASRVQSALTTRKVTGSMAGVVKAMDAAMKGMNLEKISSLMEKFESQFEDLDVQSSVME 135
            .|::.|::.|:|:..::.::|.||:.....:....:.|||.::..:..:||.|.:.:..:...|:
Yeast    83 KAQLQAISLRIQAVRSSDQMTRSMSEATGLLAGMNRTMNLPQLQRISMEFEKQSDLMGQRQEFMD 147

  Fly   136 GTMSDTVTTSVPQG-DVDNLLQQVADEAGLELNMEL---PSGVQSQSVGASTAV----------- 185
            ..:.:.:...|.:. :.|.::.:|.||.|::||.:|   |..:.|.:..|.||:           
Yeast   148 EAIDNVMGDEVDEDEEADEIVNKVLDEIGVDLNSQLQSTPQNLVSNAPIAETAMGIPEPIGAGSE 212

  Fly   186 --SQEQDELTQRLARLRQ 201
              ....|:|..||..|::
Yeast   213 FHGNPDDDLQARLNTLKK 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chmp1NP_001287108.1 Snf7 42..>167 CDD:419749 26/125 (21%)
DID4NP_012924.2 Did4 38..229 CDD:227778 43/190 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.