DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chmp1 and chmp2a

DIOPT Version :9

Sequence 1:NP_001287108.1 Gene:Chmp1 / 40036 FlyBaseID:FBgn0036805 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_998682.1 Gene:chmp2a / 798901 ZFINID:ZDB-GENE-040426-2922 Length:220 Species:Danio rerio


Alignment Length:198 Identity:57/198 - (28%)
Similarity:104/198 - (52%) Gaps:9/198 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LKFAVKELERNSKKCEKEEKLEKAKAKKAIQKGNMDVARIHAENAIRQKNQAVNYLRMSARVDAV 77
            |..|:::|:|..::.|::||...|..||..::|.||..:|.|::.:|.:.....::.|.|.:.||
Zfish    22 LNRAMRDLDRERQRLEQQEKKIIADIKKMAKQGQMDAVKIMAKDLVRTRRYVKKFIMMRANIQAV 86

  Fly    78 ASRVQSALTTRKVTGSMAGVVKAMDAAMKGMNLEKISSLMEKFESQFEDLDVQSSVMEGTMSDTV 142
            :.::|:..:...:..:|.||.|||....:.:.|.:|..:|.:||.|.|.:|::..:|...:.|.:
Zfish    87 SLKIQTLKSNNSMAQAMKGVTKAMATMNRQLKLPQIQKIMMEFERQSEIMDMKEEMMNDAIDDAM 151

  Fly   143 TTSVPQGDVDNLLQQVADEAGLELNME---LPSGVQSQSVGA------STAVSQEQDELTQRLAR 198
            .....:.:.|.::.||.||.||.|:.|   ||:...|.||.|      ...::....:|.:||..
Zfish   152 GDEDDEEESDAVVSQVLDELGLTLSDELSNLPATGGSLSVAAGKKAEPQPTLADADADLEERLNN 216

  Fly   199 LRQ 201
            ||:
Zfish   217 LRR 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chmp1NP_001287108.1 Snf7 42..>167 CDD:419749 34/124 (27%)
chmp2aNP_998682.1 Snf7 17..185 CDD:281366 48/162 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 184..220 9/36 (25%)
MIT-interacting motif 208..218 3/9 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.