DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chmp1 and 2610002M06Rik

DIOPT Version :9

Sequence 1:NP_001287108.1 Gene:Chmp1 / 40036 FlyBaseID:FBgn0036805 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_080197.2 Gene:2610002M06Rik / 67028 MGIID:1914278 Length:199 Species:Mus musculus


Alignment Length:197 Identity:148/197 - (75%)
Similarity:169/197 - (85%) Gaps:2/197 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SSMEKHLFNLKFAVKELERNSKKCEKEEKLEKAKAKKAIQKGNMDVARIHAENAIRQKNQAVNYL 68
            |:|||||||||||.|||.||:|||:||||.||||.||||||||.:||||||||||||||||:|:|
Mouse     2 SNMEKHLFNLKFAAKELNRNAKKCDKEEKAEKAKIKKAIQKGNTEVARIHAENAIRQKNQAINFL 66

  Fly    69 RMSARVDAVASRVQSALTTRKVTGSMAGVVKAMDAAMKGMNLEKISSLMEKFESQFEDLDVQSSV 133
            ||||||||||:|||:|:|..|||.|||||||:|||.::.|||||||:||:|||.|||.||||:..
Mouse    67 RMSARVDAVAARVQTAVTMGKVTKSMAGVVKSMDATLRSMNLEKISALMDKFEHQFETLDVQTQQ 131

  Fly   134 MEGTMSDTVTTSVPQGDVDNLLQQVADEAGLELNMELPSGVQSQSVGASTAVSQEQDELTQRLAR 198
            ||.|||.|.|.:.||..||.|||::||||||:||||||.| |:.|||||.| |.|||||:|||||
Mouse   132 MEDTMSSTTTLTTPQNQVDMLLQEMADEAGLDLNMELPQG-QTGSVGASVA-STEQDELSQRLAR 194

  Fly   199 LR 200
            ||
Mouse   195 LR 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chmp1NP_001287108.1 Snf7 42..>167 CDD:419749 90/124 (73%)
2610002M06RikNP_080197.2 Snf7 49..>165 CDD:419749 83/115 (72%)
Interaction with IST1. /evidence=ECO:0000250 132..156 14/23 (61%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 167..199 24/32 (75%)
Interaction with SPAST. /evidence=ECO:0000250 174..199 19/24 (79%)
Interaction with VTA1. /evidence=ECO:0000250 180..199 14/18 (78%)
Interaction with VPS4A, MITD1 and STAMBP. /evidence=ECO:0000250 180..196 12/16 (75%)
Interaction with VPS4B. /evidence=ECO:0000250 183..199 12/14 (86%)
MIT-interacting motif 186..196 8/9 (89%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830713
Domainoid 1 1.000 235 1.000 Domainoid score I2350
eggNOG 1 0.900 - - E1_COG5491
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H22046
Inparanoid 1 1.050 279 1.000 Inparanoid score I2895
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53616
OrthoDB 1 1.010 - - D1441797at2759
OrthoFinder 1 1.000 - - FOG0001910
OrthoInspector 1 1.000 - - otm43797
orthoMCL 1 0.900 - - OOG6_100996
Panther 1 1.100 - - LDO PTHR10476
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R315
SonicParanoid 1 1.000 - - X3097
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.800

Return to query results.
Submit another query.