DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chmp1 and CHMP3

DIOPT Version :9

Sequence 1:NP_001287108.1 Gene:Chmp1 / 40036 FlyBaseID:FBgn0036805 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_057163.1 Gene:CHMP3 / 51652 HGNCID:29865 Length:222 Species:Homo sapiens


Alignment Length:223 Identity:50/223 - (22%)
Similarity:99/223 - (44%) Gaps:44/223 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KHLFN-----LKFAVKELERNSKKCEKEEKLEKAKAKKAIQKGNMDVARIHAENAIRQKNQAVNY 67
            |.|.|     ::..::.::|..:..::||:..|...|.|.:||..||..:.|:..||.:......
Human    13 KELVNEWSLKIRKEMRVVDRQIRDIQREEEKVKRSVKDAAKKGQKDVCIVLAKEMIRSRKAVSKL 77

  Fly    68 LRMSARVDAVASRVQSALTTRKVTGSM---AGVVKAMDAAMKGMNLEKISSLMEKFESQFEDLDV 129
            ....|.:::|...:::.|...:|.||:   ..|:|||.:.:|   :.:|.:.|.:...:.    :
Human    78 YASKAHMNSVLMGMKNQLAVLRVAGSLQKSTEVMKAMQSLVK---IPEIQATMRELSKEM----M 135

  Fly   130 QSSVMEGTMSDTVTTSVPQGDVDNLLQQVADEAGLELNMEL-----------PSGV-----QSQS 178
            ::.::|..:.||..:...|       :::.:||.:|::..|           ||.|     :.:.
Human   136 KAGIIEEMLEDTFESMDDQ-------EEMEEEAEMEIDRILFEITAGALGKAPSKVTDALPEPEP 193

  Fly   179 VGASTAVSQEQDE------LTQRLARLR 200
            .||..|...|::|      :..|||.||
Human   194 PGAMAASEDEEEEEEALEAMQSRLATLR 221

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Chmp1NP_001287108.1 Snf7 42..>167 CDD:419749 27/127 (21%)
CHMP3NP_057163.1 Intramolecular interaction with C-terminus 2..113 23/99 (23%)
Snf7 18..187 CDD:308778 37/182 (20%)
Important for autoinhibitory function 59..64 1/4 (25%)
Interaction with VPS4A 151..222 18/78 (23%)
Intramolecular interaction with N-terminus 151..220 16/75 (21%)