DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chmp1 and chmp1a

DIOPT Version :9

Sequence 1:NP_001287108.1 Gene:Chmp1 / 40036 FlyBaseID:FBgn0036805 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_956857.1 Gene:chmp1a / 393535 ZFINID:ZDB-GENE-040426-1474 Length:198 Species:Danio rerio


Alignment Length:199 Identity:101/199 - (50%)
Similarity:153/199 - (76%) Gaps:6/199 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 MEKHLFNLKFAVKELERNSKKCEKEEKLEKAKAKKAIQKGNMDVARIHAENAIRQKNQAVNYLRM 70
            |:..||.|||..|:|||.:||.||:.|.|:||.|||:|:.|::.||::||||||:||:.:|:|||
Zfish     1 MDDTLFQLKFTSKQLERLAKKAEKDSKSEQAKVKKALQQKNVECARVYAENAIRKKNEGLNWLRM 65

  Fly    71 SARVDAVASRVQSALTTRKVTGSMAGVVKAMDAAMKGMNLEKISSLMEKFESQFEDLDVQSSVME 135
            ::|||||||:||:|||.:.|..:|..|.||:|.|:..|:|:|:|::|:|||:|.::|||.:||||
Zfish    66 ASRVDAVASKVQTALTMKGVAKNMTQVTKALDKALSSMDLQKVSAVMDKFETQVQNLDVHTSVME 130

  Fly   136 GTMSDTVTTSVPQGDVDNLLQQVADEAGLELN---MELPSGVQSQSVGASTAVSQE-QDELTQRL 196
            .:||...|.|.||..||:|:.|:|:|:|||:.   .:||:|  :.::|.::|.:|| :|:|::||
Zfish   131 DSMSSATTLSTPQQQVDDLILQIAEESGLEVEDQLSQLPAG--ASALGETSARAQEKEDQLSRRL 193

  Fly   197 ARLR 200
            |.||
Zfish   194 AALR 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chmp1NP_001287108.1 Snf7 42..>167 CDD:419749 66/124 (53%)
chmp1aNP_956857.1 Snf7 13..>170 CDD:304451 82/156 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 171..198 12/29 (41%)
MIT-interacting motif 187..197 5/9 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53616
OrthoDB 1 1.010 - - D1441797at2759
OrthoFinder 1 1.000 - - FOG0001910
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100996
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R315
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.