DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chmp1 and CHMP2B

DIOPT Version :9

Sequence 1:NP_001287108.1 Gene:Chmp1 / 40036 FlyBaseID:FBgn0036805 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_647947.1 Gene:CHMP2B / 38599 FlyBaseID:FBgn0035589 Length:212 Species:Drosophila melanogaster


Alignment Length:198 Identity:46/198 - (23%)
Similarity:95/198 - (47%) Gaps:14/198 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 NLKFAVKELERNSKKCEKEEKLEKAKAKKAIQKGNMDVARIHAENAIRQKNQAVNYLRMSARVDA 76
            :|:.|.:::||..:|.|:||:..:.:.::....||.|..||.|:       |.|...:..:|..|
  Fly    22 SLRKATRDIERERRKMEEEERKLELEIRRNAAAGNNDACRILAK-------QLVEIRKQKSRTYA 79

  Fly    77 VASRVQSALTTRKVTG-------SMAGVVKAMDAAMKGMNLEKISSLMEKFESQFEDLDVQSSVM 134
            .|.::||.....|..|       :|....|.|....|.|..|.|...:.:|::....:::...::
  Fly    80 AAGKIQSIGYQNKNMGANIALSEAMGTTAKTMGEMNKVMRPEAIGETVRQFQAANMKMEMTDEMI 144

  Fly   135 EGTMSDTVTTSVPQGDVDNLLQQVADEAGLELNMELPSGVQSQSVGASTAVSQEQDELTQRLARL 199
            ..|:.|.:..|..:.:.:.::.:|.||.|:|::.::.|...:.|....|:..:.:.::..:||:|
  Fly   145 NDTLDDMLNESGDEEESNAVVNKVLDEIGIEISGKMSSIPATGSSDFETSGKRTEKDIADQLAKL 209

  Fly   200 RQA 202
            |.:
  Fly   210 RSS 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chmp1NP_001287108.1 Snf7 42..>167 CDD:419749 31/131 (24%)
CHMP2BNP_647947.1 Snf7 18..186 CDD:281366 40/170 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438217
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5491
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10476
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.