DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chmp1 and Chmp2a

DIOPT Version :9

Sequence 1:NP_001287108.1 Gene:Chmp1 / 40036 FlyBaseID:FBgn0036805 Length:203 Species:Drosophila melanogaster
Sequence 2:XP_006228179.1 Gene:Chmp2a / 365191 RGDID:1305050 Length:247 Species:Rattus norvegicus


Alignment Length:225 Identity:62/225 - (27%)
Similarity:105/225 - (46%) Gaps:36/225 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LKFAVKELERNSKKCEKEEKLEKAKAKKAIQKGNMDVARIHAENAIRQKNQAVNYLRMSARVDAV 77
            |..|::||:|..:|.|.:||...|..||..::|.||..||.|::.:|.:.....::.|.|.:.||
  Rat    22 LNRAMRELDRERQKLETQEKKIIADIKKMAKQGQMDAVRIMAKDLVRTRRYVRKFVLMRANIQAV 86

  Fly    78 ASRVQSALTTRKVTGSMAGVVKAMDAAMK-------------------------GMNLEKISSLM 117
            :.::|:..:...:..:|.||.|||....:                         .:.|.:|..:|
  Rat    87 SLKIQTLKSNNSMAQAMKGVTKAMGTMNRQVCPSQSTFPSPLTFRQVTHPPCFFQLKLPQIQKIM 151

  Fly   118 EKFESQFEDLDVQSSVMEGTMSDTVTTSVPQGDVDNLLQQVADEAGLELNME---LPSGVQSQSV 179
            .:||.|.|.:|::..:|...:.|.:.....:.:.|.::.||.||.||.|..|   |||...|.||
  Rat   152 MEFERQAEIMDMKEEMMNDAIDDAMGDEEDEEESDAVVSQVLDELGLSLTDELSNLPSTGGSLSV 216

  Fly   180 GA--------STAVSQEQDELTQRLARLRQ 201
            .|        ::|::....:|.:||..||:
  Rat   217 AAGGKKAEATASALADADADLEERLKNLRR 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chmp1NP_001287108.1 Snf7 42..>167 CDD:419749 35/149 (23%)
Chmp2aXP_006228179.1 Snf7 17..210 CDD:397437 51/187 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.