DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chmp1 and Chmp1a

DIOPT Version :9

Sequence 1:NP_001287108.1 Gene:Chmp1 / 40036 FlyBaseID:FBgn0036805 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_001076782.1 Gene:Chmp1a / 365024 RGDID:1311083 Length:196 Species:Rattus norvegicus


Alignment Length:198 Identity:101/198 - (51%)
Similarity:150/198 - (75%) Gaps:6/198 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 MEKHLFNLKFAVKELERNSKKCEKEEKLEKAKAKKAIQKGNMDVARIHAENAIRQKNQAVNYLRM 70
            |:..||.|||..|:||:.:||.||:.|.|:||.|||:|:.|::.||::||||||:||:.||:|||
  Rat     1 MDDTLFQLKFTAKQLEKLAKKAEKDSKAEQAKVKKALQQKNVECARVYAENAIRKKNEGVNWLRM 65

  Fly    71 SARVDAVASRVQSALTTRKVTGSMAGVVKAMDAAMKGMNLEKISSLMEKFESQFEDLDVQSSVME 135
            ::|||||||:||:|:|.:.||.:||.|.||:|.|:..|:|:|:|::|::||.|.::|||.:||||
  Rat    66 ASRVDAVASKVQTAVTMKGVTKNMAQVTKALDKALSAMDLQKVSAVMDRFEQQVQNLDVHTSVME 130

  Fly   136 GTMSDTVTTSVPQGDVDNLLQQVADEAGLEL---NMELPSGVQSQSVGASTAVSQEQDELTQRLA 197
            .::|...|.:.||..||:|:.|:|:|.|||:   ..:||.|  :.:||.|:..||| |:|::|||
  Rat   131 DSVSSATTLTTPQEQVDSLIVQIAEENGLEVLDQLSQLPEG--ASAVGESSVRSQE-DQLSRRLA 192

  Fly   198 RLR 200
            .||
  Rat   193 ALR 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chmp1NP_001287108.1 Snf7 42..>167 CDD:419749 65/127 (51%)
Chmp1aNP_001076782.1 Snf7 12..195 CDD:419749 93/185 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53616
OrthoDB 1 1.010 - - D1441797at2759
OrthoFinder 1 1.000 - - FOG0001910
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100996
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.730

Return to query results.
Submit another query.