DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chmp1 and chmp1b

DIOPT Version :9

Sequence 1:NP_001287108.1 Gene:Chmp1 / 40036 FlyBaseID:FBgn0036805 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_956308.1 Gene:chmp1b / 336426 ZFINID:ZDB-GENE-030131-8370 Length:199 Species:Danio rerio


Alignment Length:197 Identity:147/197 - (74%)
Similarity:168/197 - (85%) Gaps:2/197 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SSMEKHLFNLKFAVKELERNSKKCEKEEKLEKAKAKKAIQKGNMDVARIHAENAIRQKNQAVNYL 68
            |||||||||||||.|||:||||||:||||.||.|.|||||||||:|||||||||||||||:||:|
Zfish     2 SSMEKHLFNLKFAAKELQRNSKKCDKEEKAEKVKVKKAIQKGNMEVARIHAENAIRQKNQSVNFL 66

  Fly    69 RMSARVDAVASRVQSALTTRKVTGSMAGVVKAMDAAMKGMNLEKISSLMEKFESQFEDLDVQSSV 133
            ||||||||||:|||:|:|..:||.|||||||.|||.:|.|||||||.||||||.|||.||||::.
Zfish    67 RMSARVDAVAARVQTAVTMNQVTKSMAGVVKGMDATLKSMNLEKISGLMEKFERQFETLDVQTAQ 131

  Fly   134 MEGTMSDTVTTSVPQGDVDNLLQQVADEAGLELNMELPSGVQSQSVGASTAVSQEQDELTQRLAR 198
            ||.:||.|.|.:.|||.||.|:.::||||||:||||||.| |:.|||.|.| |.|||||:||||:
Zfish   132 MEDSMSSTTTLTTPQGQVDTLMMEMADEAGLDLNMELPQG-QTGSVGTSVA-SAEQDELSQRLAK 194

  Fly   199 LR 200
            ||
Zfish   195 LR 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chmp1NP_001287108.1 Snf7 42..>167 CDD:419749 90/124 (73%)
chmp1bNP_956308.1 Snf7 40..189 CDD:304451 108/150 (72%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 167..199 22/32 (69%)
MIT-interacting motif 186..196 7/9 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573453
Domainoid 1 1.000 196 1.000 Domainoid score I3090
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 279 1.000 Inparanoid score I2894
OMA 1 1.010 - - QHG53616
OrthoDB 1 1.010 - - D1441797at2759
OrthoFinder 1 1.000 - - FOG0001910
OrthoInspector 1 1.000 - - oto39016
orthoMCL 1 0.900 - - OOG6_100996
Panther 1 1.100 - - LDO PTHR10476
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R315
SonicParanoid 1 1.000 - - X3097
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1312.940

Return to query results.
Submit another query.