DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chmp1 and chmp1a

DIOPT Version :9

Sequence 1:NP_001287108.1 Gene:Chmp1 / 40036 FlyBaseID:FBgn0036805 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_001135608.1 Gene:chmp1a / 100216166 XenbaseID:XB-GENE-5812950 Length:196 Species:Xenopus tropicalis


Alignment Length:199 Identity:103/199 - (51%)
Similarity:151/199 - (75%) Gaps:8/199 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 MEKHLFNLKFAVKELERNSKKCEKEEKLEKAKAKKAIQKGNMDVARIHAENAIRQKNQAVNYLRM 70
            |:..||.|||..|:||:.:||.||:...|:||.|||:|:.|::|||::||||||:||:.:|:|||
 Frog     1 MDDTLFQLKFTSKQLEKLAKKAEKDSNTEQAKVKKALQQKNVEVARVYAENAIRKKNEGLNWLRM 65

  Fly    71 SARVDAVASRVQSALTTRKVTGSMAGVVKAMDAAMKGMNLEKISSLMEKFESQFEDLDVQSSVME 135
            ::|||||||:||:|:|.:.||.:||.|.||:|.|:..|:|:|:|::|:||:.|.::|||.:||||
 Frog    66 ASRVDAVASKVQTAVTMKGVTKNMAQVTKALDKALSSMDLQKVSAVMDKFDQQVQNLDVHTSVME 130

  Fly   136 GTMSDTVTTSVPQGDVDNLLQQVADEAGLE----LNMELPSGVQSQSVGASTAVSQEQDELTQRL 196
            .:||..:|.:.||..||||:.|:|:|.|||    || :||.|  :.|||.|:..:.| |:|::||
 Frog   131 DSMSSAMTLTTPQEQVDNLIVQIAEENGLEVMDQLN-QLPQG--ASSVGESSTRTPE-DQLSRRL 191

  Fly   197 ARLR 200
            |.||
 Frog   192 AALR 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chmp1NP_001287108.1 Snf7 42..>167 CDD:419749 67/128 (52%)
chmp1aNP_001135608.1 Snf7 13..195 CDD:389827 95/185 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1441797at2759
OrthoFinder 1 1.000 - - FOG0001910
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.