DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sgf11 and SGF11

DIOPT Version :9

Sequence 1:NP_001097638.1 Gene:Sgf11 / 40035 FlyBaseID:FBgn0036804 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_015278.1 Gene:SGF11 / 856060 SGDID:S000005968 Length:99 Species:Saccharomyces cerevisiae


Alignment Length:103 Identity:28/103 - (27%)
Similarity:46/103 - (44%) Gaps:11/103 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LIKEPKNLDEAANYLYQSLLDDAVVGIF-NET--HHLRKSGNLAALDGVPEDSTYRMCEMPNLDI 94
            :.:|...:|..:|.:..:||...:..|. .||  ..|.|:       ..|:..:|......:|||
Yeast     1 MTEETITIDSISNGILNNLLTTLIQDIVARETTQQQLLKT-------RYPDLRSYYFDPNGSLDI 58

  Fly    95 FGISTAKKPMD-CTCPNCDRLVAAARFAPHLEKCMGMG 131
            .|:...::... ..|.||.|.|:|.|.|.||::|:..|
Yeast    59 NGLQKQQESSQYIHCENCGRDVSANRLAAHLQRCLSRG 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sgf11NP_001097638.1 Sgf11 102..134 CDD:285427 12/31 (39%)
SGF11NP_015278.1 Sgf11_N 6..44 CDD:408308 9/44 (20%)
Sgf11 67..99 CDD:369754 12/30 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2612
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003043
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104688
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.800

Return to query results.
Submit another query.