DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sgf11 and AT5G58575

DIOPT Version :9

Sequence 1:NP_001097638.1 Gene:Sgf11 / 40035 FlyBaseID:FBgn0036804 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_001318831.1 Gene:AT5G58575 / 835971 AraportID:AT5G58575 Length:181 Species:Arabidopsis thaliana


Alignment Length:128 Identity:37/128 - (28%)
Similarity:59/128 - (46%) Gaps:26/128 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 EAANYLYQSLLDDAVVGIFNETHHLRKSGNLAALDGVPE------DSTYRMCEMPN--------- 91
            :.::.::..|:|..:..:.:|.|.:.:.|....||.|.|      ::..::.:..|         
plant    13 QLSSQIFLDLVDSVIADVASECHRVARLGLDRDLDIVEEELRLSVEARAKIADPSNNLETNTKYV 77

  Fly    92 LDIFGIS---TAKKPMDCTCPNCDRLVAAARFAPHLEKCMGMGRISSRIASRRLATKEGATSA 151
            :||||.:   .|.:..:|.  ||.|.:.|.|||||||||||.||      ..|..|....|:|
plant    78 VDIFGQTHPPVASEVFNCM--NCGRQIVAGRFAPHLEKCMGKGR------KARAKTTRSTTAA 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sgf11NP_001097638.1 Sgf11 102..134 CDD:285427 18/31 (58%)
AT5G58575NP_001318831.1 Sgf11 89..121 CDD:369754 19/39 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 45 1.000 Domainoid score I4658
eggNOG 1 0.900 - - E1_KOG2612
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1407283at2759
OrthoFinder 1 1.000 - - FOG0003043
OrthoInspector 1 1.000 - - oto2977
orthoMCL 1 0.900 - - OOG6_104688
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5479
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.720

Return to query results.
Submit another query.