DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sgf11 and ATXN7L3

DIOPT Version :9

Sequence 1:NP_001097638.1 Gene:Sgf11 / 40035 FlyBaseID:FBgn0036804 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_001369245.1 Gene:ATXN7L3 / 56970 HGNCID:25416 Length:366 Species:Homo sapiens


Alignment Length:165 Identity:68/165 - (41%)
Similarity:89/165 - (53%) Gaps:16/165 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 LDEAANYLYQSLLDDAVVGIFNETHHLRKSGNLAALDGVPEDS--TYRMCEMPNLDIFG-ISTAK 101
            |:..|..:|..|::|:.:|...|.|...|.|.. .||....||  .:.:.:.|.||||| :....
Human    16 LEAIAQEIYADLVEDSCLGFCFEVHRAVKCGYF-FLDDTDPDSMKDFEIVDQPGLDIFGQVFNQW 79

  Fly   102 KPMDCTCPNCDRLVAAARFAPHLEKCMGMGRISSRIASRRLATKEGATSAHLHSSGNTGGTDDED 166
            |..:|.||||.|.:||:|||||||||:||||.|||||:||:|.......:......|    ||.:
Human    80 KSKECVCPNCSRSIAASRFAPHLEKCLGMGRNSSRIANRRIANSNNMNKSESDQEDN----DDIN 140

  Fly   167 DVDWS--SDKRRKK----SNQNS--RNNGSKKNNG 193
            |.|||  |:|:.||    .|.||  |:...|..||
Human   141 DNDWSYGSEKKAKKRKSDKNPNSPRRSKSLKHKNG 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sgf11NP_001097638.1 Sgf11 102..134 CDD:285427 22/31 (71%)
ATXN7L3NP_001369245.1 Sgf11 80..112 CDD:369754 22/31 (71%)
SCA7 <227..>256 CDD:400555
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I11102
eggNOG 1 0.900 - - E1_KOG2612
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003043
OrthoInspector 1 1.000 - - oto88933
orthoMCL 1 0.900 - - OOG6_104688
Panther 1 1.100 - - LDO PTHR46367
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4754
SonicParanoid 1 1.000 - - X5479
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.800

Return to query results.
Submit another query.