DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sgf11 and atxn7l3b

DIOPT Version :9

Sequence 1:NP_001097638.1 Gene:Sgf11 / 40035 FlyBaseID:FBgn0036804 Length:196 Species:Drosophila melanogaster
Sequence 2:XP_005156149.1 Gene:atxn7l3b / 559983 ZFINID:ZDB-GENE-030131-7685 Length:217 Species:Danio rerio


Alignment Length:174 Identity:64/174 - (36%)
Similarity:90/174 - (51%) Gaps:28/174 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 ANYLYQSLLDDAVVGIFNETHHLRKSGNLAALDGVPEDS--TYRMCEMPNLDIFG-ISTAKKPMD 105
            |..:...|::||.:|:..|.|...|.|.. .||...::|  .:.:.:.|.:|||| :....|..:
Zfish    20 AQEILSDLVEDACLGLCFEVHRAVKQGYF-FLDDTDQESMKDFEIVDQPGVDIFGQVYNQWKNKE 83

  Fly   106 CTCPNCDRLVAAARFAPHLEKCMGMGRISSRIASRRLATKEGATSAHLHSSGNTGGTDDEDDVDW 170
            |.||||.|.:||:|||||||||:||||.|||||:||:|:......:......|    ||.:|.||
Zfish    84 CVCPNCSRSIAASRFAPHLEKCLGMGRNSSRIANRRIASGNNTNKSESDQEDN----DDVNDNDW 144

  Fly   171 S--SDKRRKKS----------------NQNS--RNNGSKKNNGK 194
            |  ::|:.||.                |.||  |:...|..||:
Zfish   145 SYGAEKKAKKRKSDKVFLHSLKQPVHLNPNSPRRSKSMKHKNGR 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sgf11NP_001097638.1 Sgf11 102..134 CDD:285427 22/31 (71%)
atxn7l3bXP_005156149.1 Sgf11 80..112 CDD:285427 22/31 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I10998
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I4941
OMA 1 1.010 - - QHG46177
OrthoDB 1 1.010 - - D1407283at2759
OrthoFinder 1 1.000 - - FOG0003043
OrthoInspector 1 1.000 - - otm25515
orthoMCL 1 0.900 - - OOG6_104688
Panther 1 1.100 - - O PTHR46367
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4754
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1111.010

Return to query results.
Submit another query.