DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sgf11 and sgf11

DIOPT Version :9

Sequence 1:NP_001097638.1 Gene:Sgf11 / 40035 FlyBaseID:FBgn0036804 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_001343009.1 Gene:sgf11 / 3361397 PomBaseID:SPAC57A10.14 Length:117 Species:Schizosaccharomyces pombe


Alignment Length:140 Identity:41/140 - (29%)
Similarity:62/140 - (44%) Gaps:33/140 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 EPKNLDEAANYLYQSLLDDAVVGIFNETHHL----RKSGNLAALDGVPEDSTY--RMCEMPNLDI 94
            :|.:|...:..::::||.|       .||.|    .|:..| :|...|..:.:  :.|..|..||
pombe     2 QPASLAGISCTIFENLLKD-------YTHELTQTVHKNAKL-SLQKCPACNKHCRQYCTKPGYDI 58

  Fly    95 FG--ISTAKKPMDCTCPNCDRLVAAARFAPHLEKCMGMGRISSRIASRRLATKEGATS-AHLHSS 156
            :|  :.|.......:|..|.|.:||:|:|.|||||.|          |.|:   .||| :.|...
pombe    59 YGNSVQTPSNVPYYSCLMCKREIAASRYAAHLEKCKG----------RSLS---NATSYSTLFED 110

  Fly   157 GNTGGTDDED 166
            .|   .|:||
pombe   111 DN---ADEED 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sgf11NP_001097638.1 Sgf11 102..134 CDD:285427 13/31 (42%)
sgf11NP_001343009.1 Sgf11 68..97 CDD:285427 13/38 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003043
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104688
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.