DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GNBP1 and UTR2

DIOPT Version :9

Sequence 1:NP_524142.2 Gene:GNBP1 / 40034 FlyBaseID:FBgn0040323 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_010874.3 Gene:UTR2 / 856671 SGDID:S000000766 Length:467 Species:Saccharomyces cerevisiae


Alignment Length:265 Identity:49/265 - (18%)
Similarity:84/265 - (31%) Gaps:100/265 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 LSIANS-------------RLDLSERCTGTH---------NRIKECILHSTGSGP---------- 264
            ::|.||             |::.:..|..|.         ::..||     |:|.          
Yeast     1 MAIVNSWLICLVSIFSFVVRVEAATFCNATQACPEDKPCCSQYGEC-----GTGQYCLNNCDVRY 60

  Fly   265 ----SGIMPPIVTPRISTK-ETFAFQYGRIE-IRAKLPKGDWIV-----------PLLLLEPLTE 312
                ...||..:....||| :.::.:.|... ....:.:.||:.           .|:|..|...
Yeast    61 SFSHDSCMPVPICKSSSTKFKDYSSKLGNANTFLGNVSEADWLYTGDVLDYDDEESLILAMPKNS 125

  Fly   313 -----------WYGQSGYESGQLRVALARGNSVLRMPRGKLVDGRSLYGGPVLSTD--------- 357
                       |||:   .|.:::.:...|          :|.|..||.|.....|         
Yeast   126 GGTVLSSTRAVWYGK---VSARIKTSHLAG----------VVTGFILYSGAGDELDYEFVGADLE 177

  Fly   358 AHQREDLWLSKRKISHFG--------DDFHTYSLDWSSNRLLFSVDGQV-----YGEMLNGFTEL 409
            ..|....|.|....::..        :::|||.|||..:.:.:|:||.|     ..|..|..|:.
Yeast   178 TAQTNFYWESVLNYTNSANISTTDTFENYHTYELDWHEDYVTWSIDGVVGRTLYKNETYNATTQK 242

  Fly   410 DENPR 414
            .:.|:
Yeast   243 YQYPQ 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GNBP1NP_524142.2 CBM39 21..126 CDD:292510
GH16_beta_GRP 175..491 CDD:185688 49/265 (18%)
UTR2NP_010874.3 ChtBD1_GH16 25..71 CDD:211314 8/50 (16%)
GH16_fungal_CRH1_transglycosylase 91..302 CDD:185692 33/170 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345594
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.