DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GNBP1 and XTH28

DIOPT Version :9

Sequence 1:NP_524142.2 Gene:GNBP1 / 40034 FlyBaseID:FBgn0040323 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_172925.1 Gene:XTH28 / 838037 AraportID:AT1G14720 Length:332 Species:Arabidopsis thaliana


Alignment Length:301 Identity:62/301 - (20%)
Similarity:100/301 - (33%) Gaps:109/301 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 LLFEETFDQLNESLWIHDVRLPLDSKDAEFVLYDGKAKVHDGNLVIEPLLWSSYRPDLSIANSRL 239
            |:|...|..|.....:.  :|||...|..:....|     |.||::       :|...|:   ||
plant     8 LVFMSLFTSLVSGFALQ--KLPLIQFDEGYTQLFG-----DQNLIV-------HRDGKSV---RL 55

  Fly   240 DLSERCTGTHNRIKECILHSTGSGPSGIMPPIVTPRISTKETFAFQYGRIEIRAKLPKGDWIVPL 304
            .|.||               ||||       .|:..|       :.:|......||| .|:...:
plant    56 TLDER---------------TGSG-------FVSNDI-------YLHGFFSSSIKLP-ADYSAGV 90

  Fly   305 LLLEPLTEWYGQSG--YESGQLRVALA-RGNSVLRMPRGKLVDGR------SLYGGPVLSTDAHQ 360
            ::     .:|..:|  ||.....:... .||          :.||      ::||.........:
plant    91 VI-----AFYLSNGDLYEKNHDEIDFEFLGN----------IRGREWRIQTNIYGNGSTHLGREE 140

  Fly   361 REDLWLSKRKISHFGDDFHTYSLDWSSNRLLFSVD--------------GQVYGEMLNGFTELDE 411
            |.:||....      :|||.||:.||.:.::|.||              |....:.::.::.:.:
plant   141 RYNLWFDPT------EDFHQYSILWSLSHIIFYVDNVPIREVKRTASMGGDFPAKPMSLYSTIWD 199

  Fly   412 NPRWKQGG-------PMAPFDKMFYISLGVSVGGFGDFVDH 445
            ..:|...|       ..||:           |..|.|.:.|
plant   200 GSKWATDGGKYGVNYKYAPY-----------VSQFTDLILH 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GNBP1NP_524142.2 CBM39 21..126 CDD:292510
GH16_beta_GRP 175..491 CDD:185688 62/301 (21%)
XTH28NP_172925.1 GH16_XET 29..290 CDD:185685 55/278 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1209387at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.