DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GNBP1 and XTH25

DIOPT Version :10

Sequence 1:NP_524142.2 Gene:GNBP1 / 40034 FlyBaseID:FBgn0040323 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_568859.2 Gene:XTH25 / 835859 AraportID:AT5G57550 Length:284 Species:Arabidopsis thaliana


Alignment Length:277 Identity:58/277 - (20%)
Similarity:94/277 - (33%) Gaps:115/277 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 DAEFVLY--DGKAKV-HDGNLVIEPLLWSSYRPDLSIANSRLDLSERCTGTHNRIKECILHSTGS 262
            |.||.:.  ||:.|| ::|.|             |:::..|                    ::||
plant    31 DTEFDITWGDGRGKVLNNGEL-------------LTLSLDR--------------------ASGS 62

  Fly   263 GPSGIMPPIVTPRISTKETFAFQYGRIEIRAKLPKGD--WIVPLLLLEPLTEWYGQSGYESGQLR 325
            |            ..||:.:.|  |:|:::.||..|:  ..|....|:...:.:.:..:|     
plant    63 G------------FQTKKEYLF--GKIDMQLKLVPGNSAGTVTAYYLKSKGDTWDEIDFE----- 108

  Fly   326 VALARGNSVLRMPRGKLVDGRSLYGGP-VLST--------DAHQREDLWLSKRKISHFGDDFHTY 381
               ..||               |.|.| .:.|        |..|:..||.....      |||||
plant   109 ---FLGN---------------LTGDPYTMHTNVYTQGKGDREQQFHLWFDPTA------DFHTY 149

  Fly   382 SLDWSSNRLLFSVD-------------GQVYGEM--LNGFTELDENPRWKQGGPM-------APF 424
            |:.|:.:.::|.||             |..|.::  :..::.|....:|...|.:       |||
plant   150 SVLWNPHHIVFMVDDIPVREFKNLQHMGIQYPKLQPMRLYSSLWNADQWATRGGLVKTDWSKAPF 214

  Fly   425 D---KMFYISLGVSVGG 438
            .   :.|.....||.||
plant   215 TASYRNFRADACVSSGG 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GNBP1NP_524142.2 CBM39 21..124 CDD:464924
GH16_beta_GRP 175..491 CDD:185688 58/277 (21%)
XTH25NP_568859.2 GH16_XET 27..282 CDD:185685 58/277 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.