DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GNBP1 and XTH25

DIOPT Version :9

Sequence 1:NP_524142.2 Gene:GNBP1 / 40034 FlyBaseID:FBgn0040323 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_568859.2 Gene:XTH25 / 835859 AraportID:AT5G57550 Length:284 Species:Arabidopsis thaliana


Alignment Length:277 Identity:58/277 - (20%)
Similarity:94/277 - (33%) Gaps:115/277 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 DAEFVLY--DGKAKV-HDGNLVIEPLLWSSYRPDLSIANSRLDLSERCTGTHNRIKECILHSTGS 262
            |.||.:.  ||:.|| ::|.|             |:::..|                    ::||
plant    31 DTEFDITWGDGRGKVLNNGEL-------------LTLSLDR--------------------ASGS 62

  Fly   263 GPSGIMPPIVTPRISTKETFAFQYGRIEIRAKLPKGD--WIVPLLLLEPLTEWYGQSGYESGQLR 325
            |            ..||:.:.|  |:|:::.||..|:  ..|....|:...:.:.:..:|     
plant    63 G------------FQTKKEYLF--GKIDMQLKLVPGNSAGTVTAYYLKSKGDTWDEIDFE----- 108

  Fly   326 VALARGNSVLRMPRGKLVDGRSLYGGP-VLST--------DAHQREDLWLSKRKISHFGDDFHTY 381
               ..||               |.|.| .:.|        |..|:..||.....      |||||
plant   109 ---FLGN---------------LTGDPYTMHTNVYTQGKGDREQQFHLWFDPTA------DFHTY 149

  Fly   382 SLDWSSNRLLFSVD-------------GQVYGEM--LNGFTELDENPRWKQGGPM-------APF 424
            |:.|:.:.::|.||             |..|.::  :..::.|....:|...|.:       |||
plant   150 SVLWNPHHIVFMVDDIPVREFKNLQHMGIQYPKLQPMRLYSSLWNADQWATRGGLVKTDWSKAPF 214

  Fly   425 D---KMFYISLGVSVGG 438
            .   :.|.....||.||
plant   215 TASYRNFRADACVSSGG 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GNBP1NP_524142.2 CBM39 21..126 CDD:292510
GH16_beta_GRP 175..491 CDD:185688 58/277 (21%)
XTH25NP_568859.2 GH16_XET 27..282 CDD:185685 58/277 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1209387at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.