DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GNBP1 and XTH7

DIOPT Version :10

Sequence 1:NP_524142.2 Gene:GNBP1 / 40034 FlyBaseID:FBgn0040323 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_195494.1 Gene:XTH7 / 829936 AraportID:AT4G37800 Length:293 Species:Arabidopsis thaliana


Alignment Length:219 Identity:46/219 - (21%)
Similarity:81/219 - (36%) Gaps:48/219 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 SSYRPDLSIANSRLDLSERCTGTHNRIKECILHSTGSGPSGIMPPIVTPRISTKETFAFQYGRIE 290
            :.:..|..||.|...:::...|...::|  :..|:|.|            .::|:.:.|  ||:.
plant    32 AKFEDDFRIAWSDTHITQIDGGRAIQLK--LDPSSGCG------------FASKKQYLF--GRVS 80

  Fly   291 IRAKLPKGDWIVPLLLLEPLTEWYGQSGYESGQLRVAL------ARGNSVLRMPRGKLVDGRSLY 349
            ::.||..||      ....:|.:|..|..:|  :|..|      .|......:.......|:.  
plant    81 MKIKLIPGD------SAGTVTAFYMNSDTDS--VRDELDFEFLGNRSGQPYTVQTNVFAHGKG-- 135

  Fly   350 GGPVLSTDAHQREDLWLSKRKISHFGDDFHTYSLDWSSNRLLFSVDGQVYGEMLNGFTELDENPR 414
                   |..||.:||....:      |||.|::.|:..|::|.||........|........||
plant   136 -------DREQRVNLWFDPSR------DFHEYAISWNHLRIVFYVDNVPIRVYKNNEARKVPYPR 187

  Fly   415 WKQGGPMAPFDKMFYISLGVSVGG 438
            ::   ||..:..::......:.||
plant   188 FQ---PMGVYSTLWEADDWATRGG 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GNBP1NP_524142.2 CBM39 21..124 CDD:464924
GH16_beta_GRP 175..491 CDD:185688 46/219 (21%)
XTH7NP_195494.1 GH16_XET 32..289 CDD:185685 46/219 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.