DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GNBP1 and XTH19

DIOPT Version :10

Sequence 1:NP_524142.2 Gene:GNBP1 / 40034 FlyBaseID:FBgn0040323 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_194758.1 Gene:XTH19 / 829152 AraportID:AT4G30290 Length:277 Species:Arabidopsis thaliana


Alignment Length:261 Identity:59/261 - (22%)
Similarity:84/261 - (32%) Gaps:113/261 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 KDAEFVLYDGKAKVHD--GNLVIEPLLWSSYRPDLSIANSRLDLSERCTGTHNRIKECILHSTGS 262
            ||.:....||:.|:||  |.|             ||::   ||                 .|:||
plant    26 KDVKIHWGDGRGKIHDNQGKL-------------LSLS---LD-----------------KSSGS 57

  Fly   263 GPSGIMPPIVTPRISTKETFAFQYGRIEIRAKLPKGD---WIVPLLLLEPLTEWYGQSGYESGQL 324
            |..           |.:|   |.||:.|::.||..|:   .:....|..|.|.| .:..:|    
plant    58 GFQ-----------SNQE---FLYGKAEVQMKLVPGNSAGTVTTFYLKSPGTTW-DEIDFE---- 103

  Fly   325 RVALARGNSVLRMPRGKLVDGRSLYGGPVL---------STDAHQREDLWLSKRKISHFGDDFHT 380
                ..||               :.|.|..         |.|..|:..||.....      :|||
plant   104 ----FLGN---------------ISGHPYTLHTNVYTKGSGDKEQQFHLWFDPTA------NFHT 143

  Fly   381 YSLDWSSNRLLFSVDGQVYGEMLNG---------------FTELDENPRWKQGGPM-------AP 423
            |.:.|:..|::|:|||....|.:|.               :..|.|...|...|.:       ||
plant   144 YCITWNPQRIIFTVDGIPIREFMNAESRGVPFPTKQPMRLYASLWEAEHWATRGGLEKTDWSKAP 208

  Fly   424 F 424
            |
plant   209 F 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GNBP1NP_524142.2 CBM39 21..124 CDD:464924
GH16_beta_GRP 175..491 CDD:185688 59/261 (23%)
XTH19NP_194758.1 GH16_XET 20..276 CDD:185685 59/261 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.