DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GNBP1 and XTH24

DIOPT Version :9

Sequence 1:NP_524142.2 Gene:GNBP1 / 40034 FlyBaseID:FBgn0040323 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_194756.1 Gene:XTH24 / 829150 AraportID:AT4G30270 Length:269 Species:Arabidopsis thaliana


Alignment Length:238 Identity:50/238 - (21%)
Similarity:84/238 - (35%) Gaps:71/238 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   259 STGSGPSGIMPPIVTPRISTKETFAFQYGRIEIRAKLPKGD---WIVPLLLLEPLTEW----YGQ 316
            |:|||            ..:|..:.|  |:|:::.||..|:   .:....|....:.|    :..
plant    53 SSGSG------------FQSKTEYLF--GKIDMQIKLVPGNSAGTVTTFYLKSEGSTWDEIDFEF 103

  Fly   317 SGYESGQLRVALARGNSVLRMPRGKLVDGRSLYGGPVLSTDAHQREDLWLSKRKISHFGDDFHTY 381
            .|..||.   ......:|....:|                |..|:..||.....      :||||
plant   104 LGNMSGD---PYTLHTNVYTQGKG----------------DKEQQFHLWFDPTA------NFHTY 143

  Fly   382 SLDWSSNRLLFSVDGQVYGEMLNGFTELDENPRWKQGGPMAPFDK--MFYISL-----GVSVGGF 439
            |:.|:..|::.:||.          |.:.|...::..|.:.|.:|  ..|.||     ..:.||.
plant   144 SILWNPQRIILTVDD----------TPIREFKNYESLGVLFPKNKPMRMYASLWNADDWATRGGL 198

  Fly   440 -------GDFVDHLRTATYE-KPWANYHPQAKLQFHQAQDQWL 474
                   ..|:...|....: ||.:|::.|......||:.:|:
plant   199 VKTDWSKAPFMASYRNIKIDSKPNSNWYTQEMDSTSQARLKWV 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GNBP1NP_524142.2 CBM39 21..126 CDD:292510
GH16_beta_GRP 175..491 CDD:185688 50/238 (21%)
XTH24NP_194756.1 GH16_XET 20..265 CDD:185685 50/238 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1209387at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.