powered by:
Protein Alignment GNBP1 and XTH26
DIOPT Version :9
Sequence 1: | NP_524142.2 |
Gene: | GNBP1 / 40034 |
FlyBaseID: | FBgn0040323 |
Length: | 492 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_194614.1 |
Gene: | XTH26 / 829006 |
AraportID: | AT4G28850 |
Length: | 292 |
Species: | Arabidopsis thaliana |
Alignment Length: | 69 |
Identity: | 14/69 - (20%) |
Similarity: | 26/69 - (37%) |
Gaps: | 22/69 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 378 FHTYSLDWSSNRLLFSVDG----------------------QVYGEMLNGFTELDENPRWKQGGP 420
||.|::.|:.:.:::.||| :|:..:.|......:..|.|....
plant 143 FHNYTIHWNPSEVVWFVDGTPIRVFRNYESEGIAYPNKQGMKVFASLWNAEDWATQGGRVKTNWT 207
Fly 421 MAPF 424
:|||
plant 208 LAPF 211
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1209387at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.