DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GNBP1 and XTH14

DIOPT Version :9

Sequence 1:NP_524142.2 Gene:GNBP1 / 40034 FlyBaseID:FBgn0040323 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_194312.1 Gene:XTH14 / 828687 AraportID:AT4G25820 Length:287 Species:Arabidopsis thaliana


Alignment Length:277 Identity:60/277 - (21%)
Similarity:97/277 - (35%) Gaps:84/277 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 DLSIANSRLDLSERCTGTHNRIKECILHS-TGSGPSGIMPPIVTPRISTKETFAFQYGRIEIRAK 294
            |::..|.|.::.|     :.::..|.|.. :|||            ..:|:.:.|  |:|:::.|
plant    35 DITWGNGRANIFE-----NGQLLTCTLDKVSGSG------------FQSKKEYLF--GKIDMKLK 80

  Fly   295 LPKGD---WIVPLLLLEPLTEWYGQSGYESGQLRVALARGNSVLRMPRGKLVDGRSLYGGPVLST 356
            |..|:   .:....|....|.| .:..:|        ..||   |......:......||   ..
plant    81 LVAGNSAGTVTAYYLSSKGTAW-DEIDFE--------FLGN---RTGHPYTIHTNVFTGG---KG 130

  Fly   357 DAHQREDLWLSKRKISHFGDDFHTYSLDWSSNRLLFSVDG---QVY-GEMLNG-----------F 406
            |...:..||.....      |||||::.|:...::|.|||   :|: ....||           :
plant   131 DREMQFRLWFDPTA------DFHTYTVHWNPVNIIFLVDGIPIRVFKNNEKNGVAYPKNQPMRIY 189

  Fly   407 TELDENPRW-KQGGPM------APFDKMFYISLGVSVGGFGDFVDHLRTATYEKPWANYHPQAKL 464
            :.|.|...| .:||.:      |||.        .|...|.|.....||::  ..|....|.:  
plant   190 SSLWEADDWATEGGRVKIDWSNAPFK--------ASYRNFNDQSSCSRTSS--SKWVTCEPNS-- 242

  Fly   465 QFHQAQDQWLPTWKQPA 481
                  :.|:.|...||
plant   243 ------NSWMWTTLNPA 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GNBP1NP_524142.2 CBM39 21..126 CDD:292510
GH16_beta_GRP 175..491 CDD:185688 60/277 (22%)
XTH14NP_194312.1 GH16_XET 25..285 CDD:185685 60/277 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1209387at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.