DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GNBP1 and XTH9

DIOPT Version :10

Sequence 1:NP_524142.2 Gene:GNBP1 / 40034 FlyBaseID:FBgn0040323 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_192230.1 Gene:XTH9 / 828024 AraportID:AT4G03210 Length:290 Species:Arabidopsis thaliana


Alignment Length:234 Identity:49/234 - (20%)
Similarity:78/234 - (33%) Gaps:95/234 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   284 FQYGRIEIRAKLPKGDWIVPLLLLEPLTEWYGQS-GYESGQLRVALARGNSVLRMPRGKLVDGRS 347
            :.:|::.|:.||.:||      ....:|.:|..| |....:...... ||:.             
plant    67 YLFGKVSIQIKLVEGD------SAGTVTAFYMSSDGPNHNEFDFEFL-GNTT------------- 111

  Fly   348 LYGGP-VLSTDAH--------QREDLWLSKRKISHFGDDFHTYSLDWSSNRLLFSVDGQ------ 397
              |.| ::.|:.:        ||.:||....      .:|||||:.||...::|.||..      
plant   112 --GEPYIVQTNIYVNGVGNREQRLNLWFDPT------TEFHTYSILWSKRSVVFMVDETPIRVQK 168

  Fly   398 ----------------VYGEMLNGFTELDENPRW-KQGGPM------APFDKMFYISLGVSVGGF 439
                            ||..:.|.    |:   | .|||.:      |||           |..:
plant   169 NLEEKGIPFAKDQAMGVYSSIWNA----DD---WATQGGLVKTDWSHAPF-----------VASY 215

  Fly   440 GDF-VDHLRTATY---------EKPWANYHPQAKLQFHQ 468
            .:| :|.....|.         :|.|.:....::|..||
plant   216 KEFQIDACEIPTTTDLSKCNGDQKFWWDEPTVSELSLHQ 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GNBP1NP_524142.2 CBM39 21..124 CDD:464924
GH16_beta_GRP 175..491 CDD:185688 49/234 (21%)
XTH9NP_192230.1 GH16_XET 25..284 CDD:185685 49/234 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.