DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GNBP1 and XTH1

DIOPT Version :9

Sequence 1:NP_524142.2 Gene:GNBP1 / 40034 FlyBaseID:FBgn0040323 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_193044.3 Gene:XTH1 / 826922 AraportID:AT4G13080 Length:295 Species:Arabidopsis thaliana


Alignment Length:268 Identity:57/268 - (21%)
Similarity:90/268 - (33%) Gaps:77/268 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 NRIKECIL---HSTGSGPSGIMPPIVTPRISTKETFAFQYGRIEIRAKLPKGD--WIVPLLLLEP 309
            |:.||..|   ||:|||            ..:|.  .::.|..:||.|:|..|  .:|....|..
plant    56 NQGKEVQLSLDHSSGSG------------FESKN--HYESGFFQIRIKVPPKDTSGVVTAFYLTS 106

  Fly   310 LTEWYGQSGYE-SGQLRVALARGNSVLRMPRGKLVDGRSLYGGPVLSTDAHQREDLWLSKRKISH 373
            ....:.:..:| .|.....||...:|....:|                :..|:..||....|   
plant   107 KGNTHDEVDFEFLGNKEGKLAVQTNVFTNGKG----------------NREQKLALWFDPSK--- 152

  Fly   374 FGDDFHTYSLDWSSNRLLFSVDG---------------------QVYGEMLNGFTELDENPRWKQ 417
               |||||::.|:..:::..||.                     ||...:.||.....:..:.|.
plant   153 ---DFHTYAILWNPYQIVLYVDNIPVRVFKNTTSQGMNYPSKPMQVVVSLWNGENWATDGGKSKI 214

  Fly   418 GGPMAPFDKMFYISLGVSVGGF---GDFVDHLRTATYEKP-WANYHPQAKLQFHQAQDQWLPTWK 478
            ...:|||...|.        ||   |.|.:..:.|..... |.|....:||.  .::.:.....:
plant   215 NWSLAPFKANFQ--------GFNNSGCFTNAEKNACGSSAYWWNTGSYSKLS--DSEQKAYTNVR 269

  Fly   479 QPALKIDY 486
            |..:..||
plant   270 QKYMNYDY 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GNBP1NP_524142.2 CBM39 21..126 CDD:292510
GH16_beta_GRP 175..491 CDD:185688 57/268 (21%)
XTH1NP_193044.3 GH16_XET 34..291 CDD:185685 57/268 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1209387at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.