DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GNBP1 and XTH16

DIOPT Version :9

Sequence 1:NP_524142.2 Gene:GNBP1 / 40034 FlyBaseID:FBgn0040323 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_566738.1 Gene:XTH16 / 821955 AraportID:AT3G23730 Length:291 Species:Arabidopsis thaliana


Alignment Length:302 Identity:58/302 - (19%)
Similarity:88/302 - (29%) Gaps:140/302 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 LLWSSYRPDLSIANSRLDLS-ERCTGTHNRIKECILHSTGSGPSGIMPPIVTPRISTKETFAFQY 286
            |.|..:|..:......|.|| :|.:|                 ||..        |.||   :.:
plant    33 LTWGEHRGKIFSGGKMLSLSLDRVSG-----------------SGFK--------SKKE---YLF 69

  Fly   287 GRIEIRAKLPKGDWIVPLLLLEPLTEWYGQS-------------GYESGQLRV------ALARGN 332
            |||:::.||..|:      ....:|.:|..|             |.|:|:..|      |..:||
plant    70 GRIDMQLKLVAGN------SAGTVTAYYLSSEGPTHDEIDFEFLGNETGKPYVLHTNVFAQGKGN 128

  Fly   333 SVLRMPRGKLVDGRSLYGGPVLSTDAHQREDLWLSKRKISHFGDDFHTYSLDWSSNRLLFSVDG- 396
                                     ..|:..||....|      :||||||.|....::|.||. 
plant   129 -------------------------REQQFYLWFDPTK------NFHTYSLVWRPQHIIFMVDNV 162

  Fly   397 ---------------------QVYGEMLN--------GFTELDENPRWKQGGPMAPFDKMF--YI 430
                                 ::|..:.|        |..:.|    |.:    |||...:  :.
plant   163 PIRVFNNAEQLGVPFPKNQPMKIYSSLWNADDWATRGGLVKTD----WSK----APFTAYYRGFN 219

  Fly   431 SLGVSVGGFGDFVDHLRTATYEKPWANYHPQAKLQFHQAQDQ 472
            :...:|.....|.|               |:.|..|...:.|
plant   220 AAACTVSSGSSFCD---------------PKFKSSFTNGESQ 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GNBP1NP_524142.2 CBM39 21..126 CDD:292510
GH16_beta_GRP 175..491 CDD:185688 58/302 (19%)
XTH16NP_566738.1 GH16_XET 24..286 CDD:185685 58/302 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1209387at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.